BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_C05 (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80870.1 68414.m09489 protein kinase family protein contains ... 29 1.9 At5g18000.1 68418.m02111 transcriptional factor B3 family protei... 28 4.4 >At1g80870.1 68414.m09489 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 692 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 413 RKMMSMSSPLMEISIDGDTM--TIKNSSLLRTVXHKFKLGEXYEXKMPNSII 562 R + MS M +++DG+T + N +L H+F G+ PNS++ Sbjct: 286 RNIKEMSLNSMSLAMDGETKGKEVSNDVVLSCEDHEFDQGKEMNLLSPNSVL 337 >At5g18000.1 68418.m02111 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 307 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 542 KMPNSIIKSVTTITNDSEMXTKSVIPD 622 K S K V T++NDSE T S+IP+ Sbjct: 190 KSKTSKKKKVETVSNDSEAGTSSLIPE 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,136,926 Number of Sequences: 28952 Number of extensions: 195764 Number of successful extensions: 257 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 257 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -