BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_C02 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16C4.14c |sfc4||transcription factor TFIIIC complex subunit ... 26 4.1 >SPCC16C4.14c |sfc4||transcription factor TFIIIC complex subunit Sfc4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1006 Score = 26.2 bits (55), Expect = 4.1 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +3 Query: 6 IPALLRSSQTYALTHDTHTXNMSYEIAYSGRGRRSAASLAHLSISQ 143 IPA+ S+ +A+ D N+S +AY R + + H I Q Sbjct: 858 IPAINYYSRAFAINPDCPITNLSLGLAYLHRAMQRLSDNRHYQILQ 903 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,233,858 Number of Sequences: 5004 Number of extensions: 36765 Number of successful extensions: 88 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -