BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_C02 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF020555-1|AAB68848.1| 173|Caenorhabditis elegans lin-22 protein. 43 2e-04 AC024817-57|AAK68522.1| 173|Caenorhabditis elegans Abnormal cel... 43 2e-04 >AF020555-1|AAB68848.1| 173|Caenorhabditis elegans lin-22 protein. Length = 173 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/46 (41%), Positives = 29/46 (63%) Frame = +1 Query: 154 PMLERXRRARINRCLDELXELMVSALQSEGXNVXKLEKADILELTV 291 P++E+ RRARIN+ L +L ++++ K EKADILE+ V Sbjct: 27 PLMEKKRRARINKSLSQLKQILIQDEHKNSIQHSKWEKADILEMAV 72 >AC024817-57|AAK68522.1| 173|Caenorhabditis elegans Abnormal cell lineage protein 22 protein. Length = 173 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/46 (41%), Positives = 29/46 (63%) Frame = +1 Query: 154 PMLERXRRARINRCLDELXELMVSALQSEGXNVXKLEKADILELTV 291 P++E+ RRARIN+ L +L ++++ K EKADILE+ V Sbjct: 27 PLMEKKRRARINKSLSQLKQILIQDEHKNSIQHSKWEKADILEMAV 72 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,716,825 Number of Sequences: 27780 Number of extensions: 220376 Number of successful extensions: 434 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -