BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_B17 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 26 0.31 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 26 0.31 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.2 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 23 2.9 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 2.9 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 25.8 bits (54), Expect = 0.31 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 456 SVFKLFRIFCLLADLVQDADDTNRYVVV 539 SV+ L I + DL Q ADD NRY V Sbjct: 202 SVYHLVEISEIHFDLCQAADDLNRYFEV 229 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 25.8 bits (54), Expect = 0.31 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 456 SVFKLFRIFCLLADLVQDADDTNRYVVV 539 SV+ L I + DL Q ADD NRY V Sbjct: 198 SVYHLVEISEIHFDLCQAADDLNRYFEV 225 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.0 bits (47), Expect = 2.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -2 Query: 148 PYTVRHIFQKSSHFSQIKS*NDIKSNTIVFEVDNTR 41 PY H K S +Q+K+ I +N FE D R Sbjct: 218 PYGCEHCSMKFSDSNQLKAHVLIHTNEKPFECDKCR 253 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 22.6 bits (46), Expect = 2.9 Identities = 17/79 (21%), Positives = 33/79 (41%) Frame = -1 Query: 653 PFEVAYGRTEGLPVSGIPAQTEAVDQLFRHDSCFGRVQDYHISIGVVSVLNQVSEKTEYP 474 P+E+ YGRT P+ + + V + + ++ + NQ E T Sbjct: 342 PYEILYGRTPPNPLDAVTSGLLPVRPPLTREEIHEKARENLKHHANLRQKNQKGEVTVL- 400 Query: 473 EELENGVVSENRLVPKEET 417 E+E+ V+ +N++ T Sbjct: 401 -EIEDWVLLKNKVTSDTRT 418 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -3 Query: 624 GPPSQRHPSADRGSGPVVPPRFLLRKGAGLPH 529 GPP HPS G G + + G GL H Sbjct: 74 GPPYAPHPSLSSGLGGGLSGMPMPALGFGLGH 105 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,371 Number of Sequences: 336 Number of extensions: 3335 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -