BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_B17 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 29 0.039 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 23 3.4 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 23 3.4 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 4.5 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 7.9 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 29.1 bits (62), Expect = 0.039 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +2 Query: 119 LLKNVTNCIWYAFDSLQNNDVVHKSKLKVLTANIGTLLDLYGVEKGLDHFRSSQEL 286 L NVT D NND+ K ++A + L DLY V+ LD + S E+ Sbjct: 359 LFSNVTPKFPRNIDEYNNNDLDTKKWNNKISA-LRALNDLYNVKNTLDSYNGSMEI 413 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 471 FRIFCLLADLVQDADDTNR 527 +RI CLL+ Q+ D+T R Sbjct: 65 YRISCLLSIFKQEFDETER 83 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 471 FRIFCLLADLVQDADDTNR 527 +RI CLL+ Q+ D+T R Sbjct: 33 YRISCLLSIFKQEFDETER 51 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = +2 Query: 140 CIWYAFDSLQNNDVVHKSKLKVLTANIGTLLD 235 C W+ F+ Q HK + ++ GT+ D Sbjct: 605 CCWHCFNCTQYQIRDHKDVTQCISCRQGTVPD 636 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 116 QSFFTN*KLKRHQIKHY 66 +SF N LK HQ+ HY Sbjct: 239 KSFGYNHVLKLHQVAHY 255 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,402 Number of Sequences: 438 Number of extensions: 4272 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -