BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_B15 (515 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 1e-19 SB_2035| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_58963| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_59010| Best HMM Match : rve (HMM E-Value=0.0052) 31 0.43 SB_18915| Best HMM Match : Pox_A32 (HMM E-Value=0.052) 31 0.43 SB_56647| Best HMM Match : rve (HMM E-Value=1.5e-10) 31 0.56 SB_52974| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_55513| Best HMM Match : Pox_A32 (HMM E-Value=0.056) 31 0.74 SB_51764| Best HMM Match : Pox_A32 (HMM E-Value=0.025) 31 0.74 SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) 31 0.74 SB_45890| Best HMM Match : TMP_2 (HMM E-Value=4.4) 31 0.74 SB_42110| Best HMM Match : Pox_A32 (HMM E-Value=0.034) 31 0.74 SB_25631| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_18147| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_11644| Best HMM Match : Pox_A32 (HMM E-Value=0.026) 31 0.74 SB_10611| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_10503| Best HMM Match : Ribosomal_60s (HMM E-Value=0.46) 31 0.74 SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) 31 0.74 SB_1075| Best HMM Match : rve (HMM E-Value=0.0089) 31 0.74 SB_545| Best HMM Match : Pox_A32 (HMM E-Value=0.024) 31 0.74 SB_56578| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_53187| Best HMM Match : POPLD (HMM E-Value=4.2) 31 0.74 SB_45055| Best HMM Match : Ribosomal_60s (HMM E-Value=0.46) 31 0.74 SB_44110| Best HMM Match : DUF489 (HMM E-Value=3.3) 31 0.74 SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_35738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_29316| Best HMM Match : Pox_A32 (HMM E-Value=0.026) 31 0.74 SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) 31 0.74 SB_35991| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.88) 30 0.98 SB_3289| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_53547| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_52465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_47221| Best HMM Match : Pox_A32 (HMM E-Value=0.04) 30 0.98 SB_36582| Best HMM Match : Pox_A32 (HMM E-Value=0.067) 30 0.98 SB_34580| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.88) 30 0.98 SB_14194| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_51307| Best HMM Match : Pox_A32 (HMM E-Value=0.032) 30 1.3 SB_27971| Best HMM Match : MgtE_N (HMM E-Value=2.8) 30 1.3 SB_13424| Best HMM Match : Pox_A32 (HMM E-Value=0.073) 30 1.3 SB_49595| Best HMM Match : POPLD (HMM E-Value=1.1) 30 1.3 SB_40358| Best HMM Match : Pox_A32 (HMM E-Value=0.058) 30 1.3 SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 30 1.3 SB_34780| Best HMM Match : Pox_A32 (HMM E-Value=0.018) 30 1.3 SB_27943| Best HMM Match : Pox_A32 (HMM E-Value=0.047) 30 1.3 SB_23352| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_16524| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_473| Best HMM Match : Ribosomal_60s (HMM E-Value=0.97) 30 1.3 SB_59749| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_58745| Best HMM Match : rve (HMM E-Value=0.0023) 29 1.7 SB_56959| Best HMM Match : AAA (HMM E-Value=1.5) 29 1.7 SB_52772| Best HMM Match : rve (HMM E-Value=0.001) 29 1.7 SB_51671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_51578| Best HMM Match : Hormone_5 (HMM E-Value=1.2) 29 1.7 SB_50164| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_47639| Best HMM Match : Pox_A32 (HMM E-Value=0.075) 29 1.7 SB_45934| Best HMM Match : Gp-FAR-1 (HMM E-Value=2) 29 1.7 SB_44641| Best HMM Match : rve (HMM E-Value=1.9e-19) 29 1.7 SB_44331| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 29 1.7 SB_42508| Best HMM Match : Peptidase_U57 (HMM E-Value=4.2) 29 1.7 SB_39944| Best HMM Match : Herpes_UL46 (HMM E-Value=0.8) 29 1.7 SB_39665| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 29 1.7 SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) 29 1.7 SB_36311| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 29 1.7 SB_35449| Best HMM Match : UPF0154 (HMM E-Value=9.1) 29 1.7 SB_34512| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) 29 1.7 SB_29336| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_27884| Best HMM Match : Pox_A32 (HMM E-Value=0.61) 29 1.7 SB_27320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) 29 1.7 SB_27175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_24318| Best HMM Match : Pox_A32 (HMM E-Value=0.029) 29 1.7 SB_23010| Best HMM Match : Pox_A32 (HMM E-Value=0.012) 29 1.7 SB_21676| Best HMM Match : TrbF (HMM E-Value=0.99) 29 1.7 SB_21174| Best HMM Match : Pox_A32 (HMM E-Value=0.024) 29 1.7 SB_19215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_16259| Best HMM Match : AAA (HMM E-Value=0.43) 29 1.7 SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) 29 1.7 SB_12138| Best HMM Match : Pox_A32 (HMM E-Value=0.054) 29 1.7 SB_10435| Best HMM Match : PRAI (HMM E-Value=1.7) 29 1.7 SB_6357| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_4600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) 29 1.7 SB_2047| Best HMM Match : Ependymin (HMM E-Value=6e-05) 29 1.7 SB_591| Best HMM Match : AAA (HMM E-Value=1.5) 29 1.7 SB_59561| Best HMM Match : Pox_A32 (HMM E-Value=0.077) 29 1.7 SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_56091| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 29 1.7 SB_53051| Best HMM Match : rve (HMM E-Value=1.3e-14) 29 1.7 SB_53008| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_50078| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_48290| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_47384| Best HMM Match : Pox_A32 (HMM E-Value=0.029) 29 1.7 SB_46838| Best HMM Match : Gp-FAR-1 (HMM E-Value=1.2) 29 1.7 SB_46463| Best HMM Match : Pox_A32 (HMM E-Value=0.04) 29 1.7 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) 29 1.7 SB_43038| Best HMM Match : AAA (HMM E-Value=0.84) 29 1.7 SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_37846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_36928| Best HMM Match : Pox_A32 (HMM E-Value=0.022) 29 1.7 SB_36025| Best HMM Match : LHC (HMM E-Value=2.9) 29 1.7 SB_34881| Best HMM Match : DUF1118 (HMM E-Value=2.8) 29 1.7 SB_33845| Best HMM Match : UPF0154 (HMM E-Value=9.6) 29 1.7 SB_33050| Best HMM Match : Pox_A32 (HMM E-Value=0.0022) 29 1.7 SB_32990| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 29 1.7 SB_32372| Best HMM Match : rve (HMM E-Value=4.1e-19) 29 1.7 SB_31604| Best HMM Match : Pox_A32 (HMM E-Value=0.019) 29 1.7 SB_29678| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_26624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_13336| Best HMM Match : Pox_A32 (HMM E-Value=0.049) 29 1.7 SB_13305| Best HMM Match : Pox_A32 (HMM E-Value=0.0022) 29 1.7 SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 29 1.7 SB_8244| Best HMM Match : TMP_2 (HMM E-Value=2.4) 29 1.7 SB_2786| Best HMM Match : Pox_A32 (HMM E-Value=0.11) 29 1.7 SB_1754| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_58060| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_54102| Best HMM Match : Pox_A32 (HMM E-Value=2.6) 29 2.3 SB_48252| Best HMM Match : Ribosomal_60s (HMM E-Value=1.1) 29 2.3 SB_45220| Best HMM Match : Ribosomal_60s (HMM E-Value=0.24) 29 2.3 SB_42859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_37419| Best HMM Match : Pox_A32 (HMM E-Value=0.24) 29 2.3 SB_15317| Best HMM Match : Pox_A32 (HMM E-Value=0.013) 29 2.3 SB_3436| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_1433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_58553| Best HMM Match : rve (HMM E-Value=0.0011) 29 2.3 SB_45969| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.11) 29 2.3 SB_24570| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_53158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_23918| Best HMM Match : rve (HMM E-Value=0.013) 29 3.0 SB_5304| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_18995| Best HMM Match : rve (HMM E-Value=0.0012) 29 3.0 SB_12072| Best HMM Match : rve (HMM E-Value=2.8e-17) 29 3.0 SB_5898| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_3562| Best HMM Match : Ribosomal_60s (HMM E-Value=2.1) 29 3.0 SB_46861| Best HMM Match : Neuralized (HMM E-Value=8.5) 28 4.0 SB_33101| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_32076| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 28 4.0 SB_25935| Best HMM Match : Pox_A32 (HMM E-Value=0.048) 28 4.0 SB_25593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_51434| Best HMM Match : rve (HMM E-Value=0.0029) 28 4.0 SB_25448| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_8786| Best HMM Match : rve (HMM E-Value=0.0029) 28 4.0 SB_4794| Best HMM Match : Pox_A32 (HMM E-Value=0.085) 28 4.0 SB_815| Best HMM Match : Ribosomal_60s (HMM E-Value=0.14) 28 4.0 SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) 28 5.3 SB_49008| Best HMM Match : AAA (HMM E-Value=0.46) 28 5.3 SB_45869| Best HMM Match : ANF_receptor (HMM E-Value=0) 28 5.3 SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) 28 5.3 SB_24296| Best HMM Match : Pox_A32 (HMM E-Value=1) 28 5.3 SB_5570| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) 28 5.3 SB_56634| Best HMM Match : Pox_A32 (HMM E-Value=0.011) 28 5.3 SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_40742| Best HMM Match : Pox_A32 (HMM E-Value=0.042) 28 5.3 SB_33649| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_30354| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_29824| Best HMM Match : AAA (HMM E-Value=1.1) 28 5.3 SB_28931| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_27154| Best HMM Match : UPF0154 (HMM E-Value=9.8) 28 5.3 SB_22139| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_11640| Best HMM Match : Peptidase_C12 (HMM E-Value=3.6) 28 5.3 SB_47117| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_37063| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) 27 6.9 SB_26683| Best HMM Match : UPF0154 (HMM E-Value=7.3) 27 6.9 SB_22647| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) 27 6.9 SB_16596| Best HMM Match : Pox_A32 (HMM E-Value=0.017) 27 6.9 SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) 27 6.9 SB_28106| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_53159| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_18844| Best HMM Match : tRNA-synt_1b (HMM E-Value=0) 27 9.2 SB_8388| Best HMM Match : ig (HMM E-Value=8.80001e-41) 27 9.2 SB_54542| Best HMM Match : Ribosomal_60s (HMM E-Value=0.39) 27 9.2 SB_43987| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_40686| Best HMM Match : rve (HMM E-Value=0.00016) 27 9.2 SB_16972| Best HMM Match : Ribosomal_60s (HMM E-Value=0.51) 27 9.2 >SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 93.1 bits (221), Expect = 1e-19 Identities = 48/113 (42%), Positives = 62/113 (54%), Gaps = 1/113 (0%) Frame = +1 Query: 82 MRYVAAYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGRE 261 MRYVAAYLLA LG P+A D++ IL SVGIE+D E+L KVI+EL+GK V+++I AG+ Sbjct: 650 MRYVAAYLLATLGNNKNPSAKDIKGILDSVGIESDMERLNKVISELSGKSVDEIIQAGKS 709 Query: 262 KLSSMPVGGGXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXMGFGLFD 417 KL+++P GG MGFGLFD Sbjct: 710 KLATVPTGGAVAAGGAPAAAAAGGDAKAEEKKEEKKAESEEESDDDMGFGLFD 762 >SB_2035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 540 Score = 32.7 bits (71), Expect = 0.18 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGGG 291 TP+ AD++ IL G E EK+K+ + L K +L R + VGGG Sbjct: 49 TPSKADMKAILHDYGSELSEEKMKEYMKALKTKKFSKLEFCLRYPYTIALVGGG 102 >SB_58963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 31.9 bits (69), Expect = 0.32 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELN 222 TP+ AD++ IL G E EK+K ++TE N Sbjct: 106 TPSKADMKAILHDYGAELSEEKMKDLLTENN 136 >SB_59010| Best HMM Match : rve (HMM E-Value=0.0052) Length = 935 Score = 31.5 bits (68), Expect = 0.43 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 TP+ AD++ IL G E EK+K+ + L K+ E S+ GG Sbjct: 308 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKNFSNRTMMSDECFESLLEGG 360 >SB_18915| Best HMM Match : Pox_A32 (HMM E-Value=0.052) Length = 430 Score = 31.5 bits (68), Expect = 0.43 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E AEK+K+ + L K +L Sbjct: 298 TPSKADMKAILHDYGAELSAEKMKEYMKALKTKKFSKL 335 >SB_56647| Best HMM Match : rve (HMM E-Value=1.5e-10) Length = 1347 Score = 31.1 bits (67), Expect = 0.56 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGRE--KLSSMPVG 285 TP+ AD++ IL G E EK+K+ + L K L E KL S P G Sbjct: 546 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSNLPDRQPEVSKLGSRPSG 599 >SB_52974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 660 Score = 31.1 bits (67), Expect = 0.56 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIA 249 TP+ AD++ IL G E EK+K+ + L K + IA Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKFIA 187 >SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 31.1 bits (67), Expect = 0.56 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G+E EK+K+ + L K +L Sbjct: 544 TPSKADMKAILHDYGVELSEEKMKEYMKALKTKKFSKL 581 >SB_55513| Best HMM Match : Pox_A32 (HMM E-Value=0.056) Length = 937 Score = 30.7 bits (66), Expect = 0.74 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K+ +L Sbjct: 621 TPSEADMKAILHDYGAELSEEKMKEYMKALKTKEFSKL 658 >SB_51764| Best HMM Match : Pox_A32 (HMM E-Value=0.025) Length = 812 Score = 30.7 bits (66), Expect = 0.74 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPV 282 TP+ AD++ IL G E EK+K+ + L K +L R + PV Sbjct: 515 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKLEFCLRHPYTIAPV 565 >SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) Length = 988 Score = 30.7 bits (66), Expect = 0.74 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 TP+ AD++ IL G E EK+K+ + L K E S+ GG Sbjct: 556 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSNRTMMSDECFESLLEGG 608 >SB_45890| Best HMM Match : TMP_2 (HMM E-Value=4.4) Length = 326 Score = 30.7 bits (66), Expect = 0.74 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K+ +L Sbjct: 80 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKEFSKL 117 >SB_42110| Best HMM Match : Pox_A32 (HMM E-Value=0.034) Length = 720 Score = 30.7 bits (66), Expect = 0.74 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 TP+ AD++ IL G E EK+K+ + L K E S+ GG Sbjct: 273 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSNRTMMSDECFESLLEGG 325 >SB_25631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 743 Score = 30.7 bits (66), Expect = 0.74 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAA 252 TP+ AD++ IL G E EK+K+ + L K +E + A Sbjct: 519 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKLEFCLPA 559 >SB_18147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 30.7 bits (66), Expect = 0.74 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ I L K +L Sbjct: 28 TPSKADMKAILHDYGAELSEEKMKEYIKALKTKKFSKL 65 >SB_11644| Best HMM Match : Pox_A32 (HMM E-Value=0.026) Length = 1532 Score = 30.7 bits (66), Expect = 0.74 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K+ +L Sbjct: 949 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKEFSKL 986 >SB_10611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1134 Score = 30.7 bits (66), Expect = 0.74 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K+ +L Sbjct: 148 TPSKADMKAILHDYGAELSQEKMKEYMKALKTKEFSKL 185 >SB_10503| Best HMM Match : Ribosomal_60s (HMM E-Value=0.46) Length = 787 Score = 30.7 bits (66), Expect = 0.74 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 TP+ AD++ IL G E EK+K+ + L K E S+ GG Sbjct: 559 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSNRTMMSDECFESLLEGG 611 >SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) Length = 635 Score = 30.7 bits (66), Expect = 0.74 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +1 Query: 106 LAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 +AVL TP AD++ IL G E EK+K+ + L K +L Sbjct: 375 IAVLVDFYTPRKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 420 >SB_1075| Best HMM Match : rve (HMM E-Value=0.0089) Length = 1617 Score = 30.7 bits (66), Expect = 0.74 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K+ +L Sbjct: 877 TPSEADMKAILHDYGAELSEEKMKEYMKALKTKEFSKL 914 >SB_545| Best HMM Match : Pox_A32 (HMM E-Value=0.024) Length = 454 Score = 30.7 bits (66), Expect = 0.74 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 TP+ AD++ IL G E EK+K+ + L K E S+ GG Sbjct: 252 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSNRTMMSDECFESLLEGG 304 >SB_56578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 30.7 bits (66), Expect = 0.74 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ I L K +L Sbjct: 443 TPSKADMKAILHDYGAELSEEKMKEYIKALKTKKFSKL 480 >SB_53187| Best HMM Match : POPLD (HMM E-Value=4.2) Length = 344 Score = 30.7 bits (66), Expect = 0.74 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 2/77 (2%) Frame = +1 Query: 19 LFNDE--RYSFGITRFVSIRT*KMRYVAAYLLAVLGGKTTPAAADVEKILSSVGIEADAE 192 LF+DE Y+ G + SI +AA ++ TP+ AD++ IL G E E Sbjct: 258 LFSDEGGTYNSGKQQLTSITKPFRENIAALVVFY-----TPSKADMKAILHDYGAELSEE 312 Query: 193 KLKKVITELNGKDVEQL 243 K+K+ + L K +L Sbjct: 313 KMKEYMKALKTKKFSKL 329 >SB_45055| Best HMM Match : Ribosomal_60s (HMM E-Value=0.46) Length = 741 Score = 30.7 bits (66), Expect = 0.74 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 TP+ AD++ IL G E EK+K+ + L K E S+ GG Sbjct: 80 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSNRTMMSDECFESLLEGG 132 >SB_44110| Best HMM Match : DUF489 (HMM E-Value=3.3) Length = 491 Score = 30.7 bits (66), Expect = 0.74 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 228 TP+ AD++ IL G E EK+K+ + LN K Sbjct: 447 TPSKADMKAILHDYGAELSEEKMKEYMKALNTK 479 >SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2391 Score = 30.7 bits (66), Expect = 0.74 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + +L K +L Sbjct: 1482 TPSKADMKAILHDYGAELSEEKMKEYMKDLKTKKFSKL 1519 >SB_35738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1186 Score = 30.7 bits (66), Expect = 0.74 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 106 LAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 +A L TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 277 IAALVVFNTPSKADIKAILHDYGAELSEEKMKEYMKALKTKKFSKL 322 >SB_29316| Best HMM Match : Pox_A32 (HMM E-Value=0.026) Length = 288 Score = 30.7 bits (66), Expect = 0.74 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ I L K +L Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYIKALKTKKFSKL 185 >SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) Length = 1616 Score = 30.7 bits (66), Expect = 0.74 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPV 282 TP+ AD++ IL G E EK+K+ + L K +L R + PV Sbjct: 932 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKLEFCLRHPYTIAPV 982 >SB_35991| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.88) Length = 669 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K+ +L Sbjct: 210 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKNFSKL 247 >SB_3289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 500 Score = 30.3 bits (65), Expect = 0.98 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 TP+ AD++ IL G E EK+K+ + L K +L R + V G Sbjct: 448 TPSKADMKAILHDYGAEVSEEKMKEYMKALKTKKFSKLEFCSRHPYTIALVEG 500 >SB_53547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1381 Score = 30.3 bits (65), Expect = 0.98 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 106 LAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 +A L TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1336 IAALVVNYTPSKADMKAILHDYGAELSEEKMKEYMKALKKKKFSKL 1381 >SB_52465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 30.3 bits (65), Expect = 0.98 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ I L K +L Sbjct: 146 TPSKADMKAILHDYGAELPEEKMKEYIKALKTKKFSKL 183 >SB_47221| Best HMM Match : Pox_A32 (HMM E-Value=0.04) Length = 263 Score = 30.3 bits (65), Expect = 0.98 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 TP+ AD++ IL G E EK+K+ L K E S+ GG Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYTKALKTKKFSNRTMMSDEYFESLLEGG 200 >SB_36582| Best HMM Match : Pox_A32 (HMM E-Value=0.067) Length = 367 Score = 30.3 bits (65), Expect = 0.98 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ I L K +L Sbjct: 146 TPSKADMKAILHDYGAELPEEKMKEYIKALKTKKFSKL 183 >SB_34580| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.88) Length = 953 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K+ +L Sbjct: 410 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKNFSKL 447 >SB_14194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL+ G E EK+K+ + L K +L Sbjct: 555 TPSKADMKAILNDYGAELSEEKMKEYMKALKTKKFSKL 592 >SB_51307| Best HMM Match : Pox_A32 (HMM E-Value=0.032) Length = 1036 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 106 LAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 +A L TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 976 IAALVVSYTPSKADMKAILHDYGAELSEEKMKEYMKVLKTKKFSKL 1021 >SB_27971| Best HMM Match : MgtE_N (HMM E-Value=2.8) Length = 235 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +1 Query: 139 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 258 AADV+K+++S G AD +KL I DV++LIA+G+ Sbjct: 9 AADVDKLIAS-GKAADVDKL---IASGKAADVDKLIASGK 44 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +1 Query: 139 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 258 AADV+K+++S G AD +KL I DV++LIA+G+ Sbjct: 21 AADVDKLIAS-GKAADVDKL---IASGKAADVDKLIASGK 56 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +1 Query: 139 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 258 AADV+K+++S G AD +KL I DV++LIA+G+ Sbjct: 33 AADVDKLIAS-GKAADVDKL---IASGKAADVDKLIASGK 68 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +1 Query: 139 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 258 AADV+K+++S G AD +KL I DV++LIA+G+ Sbjct: 45 AADVDKLIAS-GKAADVDKL---IASGKAADVDKLIASGK 80 Score = 27.9 bits (59), Expect = 5.3 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +1 Query: 139 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 258 AADV+K+++S A L K+I DV++LIA+G+ Sbjct: 105 AADVDKLIAS----GKAGDLDKLIASGKAADVDKLIASGK 140 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +1 Query: 139 AADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGR 258 AAD +K+++S G AD +KL I DV++LIA+G+ Sbjct: 81 AADGDKLIAS-GKAADVDKL---IASGKAADVDKLIASGK 116 >SB_13424| Best HMM Match : Pox_A32 (HMM E-Value=0.073) Length = 1387 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1255 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSEL 1292 >SB_49595| Best HMM Match : POPLD (HMM E-Value=1.1) Length = 1141 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 754 TPSKADMKAILHDYGAELSEEKMKEYMNALKTKKFSKL 791 >SB_40358| Best HMM Match : Pox_A32 (HMM E-Value=0.058) Length = 874 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 TP+ AD++ IL G E EK+K+ + L K + S+ GG Sbjct: 423 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSNRTMMSDDYFESLLEGG 475 >SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1411 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 940 TPSKADMKAILHDYGAELSEEKMKEYMNALKTKKFSKL 977 >SB_34780| Best HMM Match : Pox_A32 (HMM E-Value=0.018) Length = 625 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 106 LAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 +A L TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 256 IAALVVFNTPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 301 >SB_27943| Best HMM Match : Pox_A32 (HMM E-Value=0.047) Length = 983 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 TP+ AD++ IL G E EK+K+ + L K E S GG Sbjct: 447 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSNRTMMSDECFESFLEGG 499 >SB_23352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1830 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 533 TPSKADMKAILHDYGAELSGEKMKEYMKALKTKKFSKL 570 >SB_16524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 616 TPSKADMKAILQDYGAELSEEKMKEYMRALKTKKFSKL 653 >SB_473| Best HMM Match : Ribosomal_60s (HMM E-Value=0.97) Length = 757 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 472 TPSKADMKAILHDYGAELSEEKMKQYMKALKTKQFSKL 509 >SB_59749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1091 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 551 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 588 >SB_58745| Best HMM Match : rve (HMM E-Value=0.0023) Length = 943 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 460 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 497 >SB_56959| Best HMM Match : AAA (HMM E-Value=1.5) Length = 189 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 138 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 175 >SB_52772| Best HMM Match : rve (HMM E-Value=0.001) Length = 646 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 238 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 275 >SB_51671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 665 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 429 TPSKADMKAILHDYGAELSKEKMKEYMKALKTKKFSKL 466 >SB_51578| Best HMM Match : Hormone_5 (HMM E-Value=1.2) Length = 622 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 35 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 72 >SB_50164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1780 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1547 TPSRADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1584 >SB_47639| Best HMM Match : Pox_A32 (HMM E-Value=0.075) Length = 911 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 304 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 341 >SB_45934| Best HMM Match : Gp-FAR-1 (HMM E-Value=2) Length = 694 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 +P+ AD+E IL G E EK+K+ + L K +L Sbjct: 540 SPSKADMEAILHDYGAELSEEKMKECMKALKTKKFSKL 577 >SB_44641| Best HMM Match : rve (HMM E-Value=1.9e-19) Length = 840 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 111 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 148 >SB_44331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1916 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1373 TPSKADMKAILHDYGAELSEEKMKEYMKTLKTKKFSKL 1410 >SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1227 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 689 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 726 >SB_42508| Best HMM Match : Peptidase_U57 (HMM E-Value=4.2) Length = 703 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 406 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 443 >SB_39944| Best HMM Match : Herpes_UL46 (HMM E-Value=0.8) Length = 636 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 146 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 183 >SB_39665| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 1640 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1046 TPSKADMKAILHDYGAELSEEKIKEYMKALKTKKFSKL 1083 >SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) Length = 1144 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 536 TPSKADMKAILHDYGAELSKEKMKEYMKALKTKKFSKL 573 >SB_36311| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 869 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 343 TPSKADMKAILHDYGAELSEEKIKEYMKALKTKKFSKL 380 >SB_35449| Best HMM Match : UPF0154 (HMM E-Value=9.1) Length = 101 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 49 TPSRADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 86 >SB_34512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1080 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 412 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 449 >SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) Length = 1081 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 371 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 408 >SB_29336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1047 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 548 TPSRADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 585 >SB_27884| Best HMM Match : Pox_A32 (HMM E-Value=0.61) Length = 1226 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1043 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1080 >SB_27320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 467 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 504 >SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) Length = 1115 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 288 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 325 >SB_27175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1720 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1197 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1234 >SB_24318| Best HMM Match : Pox_A32 (HMM E-Value=0.029) Length = 598 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 546 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 583 >SB_23010| Best HMM Match : Pox_A32 (HMM E-Value=0.012) Length = 776 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 556 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 593 >SB_21676| Best HMM Match : TrbF (HMM E-Value=0.99) Length = 681 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K + +L Sbjct: 88 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKMLSKL 125 >SB_21174| Best HMM Match : Pox_A32 (HMM E-Value=0.024) Length = 702 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 426 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 463 >SB_19215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 546 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 583 >SB_16259| Best HMM Match : AAA (HMM E-Value=0.43) Length = 538 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 426 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 463 >SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) Length = 804 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 416 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 453 >SB_12138| Best HMM Match : Pox_A32 (HMM E-Value=0.054) Length = 409 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 185 >SB_10435| Best HMM Match : PRAI (HMM E-Value=1.7) Length = 379 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 124 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 161 >SB_6357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1650 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 987 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1024 >SB_4600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1140 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDV 234 TP+ AD++ IL G E EK+K+ + L K V Sbjct: 666 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKV 700 >SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) Length = 1266 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 492 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 529 >SB_2047| Best HMM Match : Ependymin (HMM E-Value=6e-05) Length = 739 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 185 >SB_591| Best HMM Match : AAA (HMM E-Value=1.5) Length = 542 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 490 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 527 >SB_59561| Best HMM Match : Pox_A32 (HMM E-Value=0.077) Length = 986 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 416 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 453 >SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2541 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1702 TPSKADMKTILHDYGAELSEEKMKEYMKALKTKKFSKL 1739 >SB_56091| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 914 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 504 TPSKADMKAILHDYGAELSKEKMKEYMKALKTKKFSKL 541 >SB_53051| Best HMM Match : rve (HMM E-Value=1.3e-14) Length = 1624 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 870 TPSKADMKAILHDYGAELSEEKMKECMKALKTKKFSKL 907 >SB_53008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 185 >SB_50078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 132 TPSKADMKAILHDYGTELSEEKIKEYMEALKKKKFSKL 169 >SB_48290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL + G E EK+K+ + L K +L Sbjct: 449 TPSKADMKAILHAYGAELSEEKMKEYMKALKTKKFPKL 486 >SB_47384| Best HMM Match : Pox_A32 (HMM E-Value=0.029) Length = 327 Score = 29.5 bits (63), Expect = 1.7 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGGG 291 TP+ AD++ IL G E EK+K+ + L K E S GGG Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKESMKALKTKKFLNRTMMCDECFESFLEGGG 201 >SB_46838| Best HMM Match : Gp-FAR-1 (HMM E-Value=1.2) Length = 512 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 49 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 86 >SB_46463| Best HMM Match : Pox_A32 (HMM E-Value=0.04) Length = 235 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 144 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 181 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 751 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 788 >SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) Length = 1851 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1220 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1257 >SB_43038| Best HMM Match : AAA (HMM E-Value=0.84) Length = 957 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 551 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 588 >SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 476 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 513 >SB_37846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 94 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 131 >SB_36928| Best HMM Match : Pox_A32 (HMM E-Value=0.022) Length = 496 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 148 TPSKADMKTILHDYGAELSEEKMKEYMKALKTKKFSKL 185 >SB_36025| Best HMM Match : LHC (HMM E-Value=2.9) Length = 671 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 289 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 326 >SB_34881| Best HMM Match : DUF1118 (HMM E-Value=2.8) Length = 382 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 234 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 271 >SB_33845| Best HMM Match : UPF0154 (HMM E-Value=9.6) Length = 132 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 80 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 117 >SB_33050| Best HMM Match : Pox_A32 (HMM E-Value=0.0022) Length = 560 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 382 TPSKADMKTILHDYGAELSEEKMKEYMKALKTKKFSKL 419 >SB_32990| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 594 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 358 TPSKADMKAILHDYGAELSEEKIKEYMKALKTKKFSKL 395 >SB_32372| Best HMM Match : rve (HMM E-Value=4.1e-19) Length = 1562 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1134 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1171 >SB_31604| Best HMM Match : Pox_A32 (HMM E-Value=0.019) Length = 802 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 576 TPSKADMKAILHDYGAELSEEKMKEYMKTLKTKKFSKL 613 >SB_29678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 851 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 393 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 430 >SB_26624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 185 >SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 957 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD + IL G E EK+K+ + L K+ +L Sbjct: 544 TPSKADKKAILHDYGAELSEEKMKEYMKALKTKEFSKL 581 >SB_13336| Best HMM Match : Pox_A32 (HMM E-Value=0.049) Length = 960 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ +L G E EK+K+ + L K +L Sbjct: 546 TPSKADMKAVLHDYGAELSEEKMKEYMNALKTKKFSKL 583 >SB_13305| Best HMM Match : Pox_A32 (HMM E-Value=0.0022) Length = 578 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 400 TPSKADMKTILHDYGAELSEEKMKEYMKALKTKKFSKL 437 >SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 1152 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 508 TPSRADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 545 >SB_8244| Best HMM Match : TMP_2 (HMM E-Value=2.4) Length = 259 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 96 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 133 >SB_2786| Best HMM Match : Pox_A32 (HMM E-Value=0.11) Length = 1182 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 982 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1019 >SB_1754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1521 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1137 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKKFSKL 1174 >SB_58060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 863 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKRFSKL 185 >SB_54102| Best HMM Match : Pox_A32 (HMM E-Value=2.6) Length = 268 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +1 Query: 88 YVAAYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 +V A +A L TP+ AD++ +L G E EK+++ + L K +L Sbjct: 122 WVIAENIAALVVFYTPSKADMKAVLHDYGAELSEEKMREYMKALKTKKFSKL 173 >SB_48252| Best HMM Match : Ribosomal_60s (HMM E-Value=1.1) Length = 937 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 397 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKRFSKL 434 >SB_45220| Best HMM Match : Ribosomal_60s (HMM E-Value=0.24) Length = 362 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K+ + + Sbjct: 124 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKNHDMM 161 >SB_42859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1370 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1116 TPSKADMKAILHDYGAELSEEKMKECMKALKTKRFSKL 1153 >SB_37419| Best HMM Match : Pox_A32 (HMM E-Value=0.24) Length = 1497 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1103 TPSKADMKAILHDYGAEFSEEKMKEYMKALKTKKFSKL 1140 >SB_15317| Best HMM Match : Pox_A32 (HMM E-Value=0.013) Length = 1124 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 505 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKRFSKL 542 >SB_3436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ L G E EK+K+ + L K+ +L Sbjct: 75 TPSKADMKAFLHDYGAELSEEKMKEYMKALKTKEFSKL 112 >SB_1433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD+ IL G E EK+K+ + L K +L Sbjct: 548 TPSKADMRAILHDYGAELSEEKMKEYMKALKTKKFSKL 585 >SB_58553| Best HMM Match : rve (HMM E-Value=0.0011) Length = 1745 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 TP+ AD++ IL G E EK+K+ + L + E S+ GG Sbjct: 882 TPSKADMKAILHDYGAELSEEKMKEYMKALKTEKFSNRTMMSDECFESLLEGG 934 >SB_45969| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.11) Length = 735 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 484 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKRFSKL 521 >SB_24570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 502 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 106 LAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 +A L TP+ AD++ IL G E +K+K+ + L K +L Sbjct: 446 IAALVAFYTPSKADMKAILHDYGAELSEDKMKEYMKALKTKKFSKL 491 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ +L G E EK+K+ + L K +L Sbjct: 1855 TPSKADMKAVLHDYGAELSEEKMKEYMKALKTKKFSKL 1892 >SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2235 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +1 Query: 88 YVAAYLLAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 +V A +A L TP+ AD++ +L G E EK+++ + L K +L Sbjct: 1565 WVIAENIAALVVFYTPSKADMKAVLHDYGAELSEEKMREYMKALKTKKFSKL 1616 >SB_53158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ L K +L Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYTKALKTKKFSKL 185 >SB_23918| Best HMM Match : rve (HMM E-Value=0.013) Length = 1785 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD+ IL G E EK+K+ + L K +L Sbjct: 909 TPSKADINVILHDYGAELSEEKMKENMKALKTKKFSKL 946 >SB_5304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 49 TPSKADMKAILHDYGAERSEEKMKEHMKALKTKKFSKL 86 >SB_18995| Best HMM Match : rve (HMM E-Value=0.0012) Length = 1225 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVI 210 TP+ AD++ IL G+E EK+K+ + Sbjct: 416 TPSKADMKAILHDYGVELSEEKMKEAL 442 >SB_12072| Best HMM Match : rve (HMM E-Value=2.8e-17) Length = 1693 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 1003 TPSKADMKAILHDYGSELSEEKMKEYMKALKMKKFSKL 1040 >SB_5898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVG 285 TP+ AD++ +L G E EK+K+ + L K E S+ G Sbjct: 511 TPSKADMKAVLHDYGAELSEEKMKEYMKALKTKKFSNRTMMSEECFESLLEG 562 >SB_3562| Best HMM Match : Ribosomal_60s (HMM E-Value=2.1) Length = 254 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKD 231 TP+ AD++ IL G E EK+K+ + L K+ Sbjct: 21 TPSKADMKAILHDYGAELSEEKMKEYMKALKTKN 54 >SB_46861| Best HMM Match : Neuralized (HMM E-Value=8.5) Length = 217 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 228 TP+ AD++ IL G E EK+K+ + L K Sbjct: 165 TPSKADMKAILHDYGAELSEEKMKEYMKALKTK 197 >SB_33101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K + L K +L Sbjct: 342 TPSKADMKAILHDYGAELSEEKMKVYMKALKTKKFSKL 379 >SB_32076| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 2352 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 228 TP+ AD++ IL G E EK+K+ + L K Sbjct: 1835 TPSKADMKAILHDYGAELSEEKMKEYMKALKTK 1867 >SB_25935| Best HMM Match : Pox_A32 (HMM E-Value=0.048) Length = 310 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 228 TP+ AD++ IL G E EK+K+ + L K Sbjct: 274 TPSKADMKAILHDYGAELSEEKMKEYMKALKTK 306 >SB_25593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 315 TPSKADMKAILHDYGPELSDEKMKEYMKALKTKKFSKL 352 >SB_51434| Best HMM Match : rve (HMM E-Value=0.0029) Length = 748 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 228 TP+ AD++ IL G E EK+K+ + L K Sbjct: 373 TPSKADMKAILHDYGAELSEEKIKEYMKALKTK 405 >SB_25448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 538 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 486 TPSKADMKAILHDNGAELSEEKIKEYMKALKTKKFAKL 523 >SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 228 TP+ AD++ +L G E EK+K+ + L K Sbjct: 509 TPSKADMKAVLHDYGAELSEEKMKEYMNALKTK 541 >SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L K +L Sbjct: 386 TPSKADMKAILHDNGAELSEEKIKEYMKALKTKKFAKL 423 >SB_8786| Best HMM Match : rve (HMM E-Value=0.0029) Length = 946 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 228 TP+ AD++ IL G E EK+K+ + L K Sbjct: 584 TPSKADMKAILHDYGAELSEEKIKEYMKALKTK 616 >SB_4794| Best HMM Match : Pox_A32 (HMM E-Value=0.085) Length = 369 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 228 TP+ AD++ IL G E EK+K+ + L K Sbjct: 333 TPSKADMKAILHDYGAELSEEKMKEYMKALKTK 365 >SB_815| Best HMM Match : Ribosomal_60s (HMM E-Value=0.14) Length = 443 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 228 TP+ AD++ IL G E EK+K+ + L K Sbjct: 250 TPSKADMKAILHDYGAELSEEKMKEYMKALETK 282 >SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) Length = 1020 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E +K+K+ + L K +L Sbjct: 335 TPSKADMKAILHDYGAELSEKKMKEYMKALKTKKFSKL 372 >SB_49008| Best HMM Match : AAA (HMM E-Value=0.46) Length = 593 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP AD++ +L G E EK+K+ L K +L Sbjct: 340 TPGKADMKAVLHDYGAELSEEKMKEYTKALKTKKFSKL 377 >SB_45869| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 939 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 29 TNVILSALHVSCQLGLKKCVTWPRIYWLCW 118 T V+LSA V GL C+ P++Y + W Sbjct: 854 TTVVLSATTVIAASGLLVCMFIPKVYIILW 883 >SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) Length = 474 Score = 27.9 bits (59), Expect = 5.3 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -1 Query: 260 SRPAAISCSTSLPLSSVIT-FLSFSASASIPTE-LRIFSTSAAAGVVLPPS 114 SRP STSL S+ T S +AS S+ T + STS+AA L P+ Sbjct: 128 SRPPPRPASTSLTTSAAFTSSTSSAASTSLTTSPVSTSSTSSAASTSLTPA 178 >SB_24296| Best HMM Match : Pox_A32 (HMM E-Value=1) Length = 1041 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + K +L Sbjct: 989 TPSKADMKAILHDYGAELSEEKMKEYMKAFKTKKFSKL 1026 >SB_5570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + K +L Sbjct: 148 TPSKADMKAILHDYGAELSEEKMKEYMKAFKTKKFSKL 185 >SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) Length = 1486 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L + +L Sbjct: 1243 TPSKADMKAILHDYGAELSEEKMKEYMKALKTEKFSKL 1280 >SB_56634| Best HMM Match : Pox_A32 (HMM E-Value=0.011) Length = 684 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ A ++ IL G E EK+K+ + L K+ +L Sbjct: 146 TPSKAGMKAILHDYGAELSEEKMKEYMKALKTKEFSKL 183 >SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 106 LAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELN 222 +A L TP+ AD++ IL G E EK+K+ + L+ Sbjct: 243 IAALVVFNTPSKADMKAILHDYGAELSEEKMKEYMKALS 281 >SB_40742| Best HMM Match : Pox_A32 (HMM E-Value=0.042) Length = 579 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E +K+K+ + L K +L Sbjct: 531 TPSKADMKAILHDYGAELSEKKMKEYMKALKTKKFSKL 568 >SB_33649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G + EK+K+ + L K +L Sbjct: 359 TPSKADMKAILHDYGAKLSEEKMKEYMKALKTKKFSKL 396 >SB_30354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E +K+K+ + L K +L Sbjct: 356 TPSKADMKAILHDYGAELSEKKMKEYMKALKTKKFSKL 393 >SB_29824| Best HMM Match : AAA (HMM E-Value=1.1) Length = 163 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G EK+K+ + L K+ +L Sbjct: 111 TPSKADMKAILHDYGAGLSEEKMKEYMKALKTKEFSKL 148 >SB_28931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1035 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E +K+K+ + L K +L Sbjct: 130 TPSKADMKAILHDYGAELSEKKMKEYLKGLKTKKFSKL 167 >SB_27154| Best HMM Match : UPF0154 (HMM E-Value=9.8) Length = 89 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ L G E EK+K+ + L K +L Sbjct: 37 TPSKADMKAFLHDYGAELSEEKMKECMKALKTKKFSKL 74 >SB_22139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K + L K +L Sbjct: 1060 TPSKADMKAILLDYGAELSEEKMKGYMKALKTKKFSKL 1097 >SB_11640| Best HMM Match : Peptidase_C12 (HMM E-Value=3.6) Length = 839 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ L G E EK+K+ + L K +L Sbjct: 594 TPSKADMKAFLHDYGAELSEEKMKECMKALKTKKFSKL 631 >SB_47117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 869 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 254 PAAISCSTSLPLSSVITFLSFSASASIPTELRIF 153 P A ++SLPL +IT +S ++ + +F Sbjct: 777 PTAAEAASSLPLMKIITITGYSVGGAVLVTIAVF 810 >SB_37063| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) Length = 462 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ D++ IL G E EK+K+ + L K +L Sbjct: 64 TPSKEDMKAILHDYGAELSEEKMKEYMEALKKKKFSKL 101 >SB_26683| Best HMM Match : UPF0154 (HMM E-Value=7.3) Length = 419 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ A ++ IL G E EK+KK + L K +L Sbjct: 367 TPSKAYMKAILHDYGAELSEEKMKKYMKALKTKKFSKL 404 >SB_22647| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) Length = 462 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ D++ IL G E EK+K+ + L K +L Sbjct: 64 TPSKEDMKAILHDYGAELSEEKMKEYMEALKKKKFSKL 101 >SB_16596| Best HMM Match : Pox_A32 (HMM E-Value=0.017) Length = 305 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ D++ IL G E EK+K+ + L K +L Sbjct: 148 TPSKEDMKAILHDYGAELSEEKMKEYMEALKKKKFSKL 185 >SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) Length = 1117 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 106 LAVLGGKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDV 234 +A L TP+ AD++ IL G E K+K+ + L ++V Sbjct: 367 IAALVVSYTPSKADIKAILHDYGAELSEGKMKEYMKALQVEEV 409 >SB_28106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1206 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ AD++ IL G E EK+K+ + L +L Sbjct: 433 TPSKADMKAILHDYGAELSEEKMKEYMKALKTNKFSKL 470 >SB_53159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1540 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQL 243 TP+ D++ IL G E EK+K+ + L K +L Sbjct: 925 TPSKTDMKAILHDYGAELSEEKMKEHMKALKTKKFSKL 962 >SB_18844| Best HMM Match : tRNA-synt_1b (HMM E-Value=0) Length = 252 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 178 EADAEKLKKVITELNGKDVEQLIAAGRE 261 + D+EK K+ T L+ K++E LIA +E Sbjct: 209 DEDSEKYIKIFTFLSQKEIETLIAEHKE 236 >SB_8388| Best HMM Match : ig (HMM E-Value=8.80001e-41) Length = 666 Score = 27.1 bits (57), Expect = 9.2 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = -3 Query: 246 NKLFNILAVELSDYFLKLLSVSFDTDGAEDLLNVSGS 136 NK+ NIL+V+ SD +K SV D+ L++SGS Sbjct: 81 NKV-NILSVDASDVDIKTYSVPIDSTLDRVTLSISGS 116 >SB_54542| Best HMM Match : Ribosomal_60s (HMM E-Value=0.39) Length = 1037 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGK 228 TP+ AD++ IL G E EK+++ + L K Sbjct: 515 TPSKADMKAILHDYGAELSEEKMREYMKALKTK 547 >SB_43987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 27.1 bits (57), Expect = 9.2 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +1 Query: 136 AAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAA-GREKLSSM 276 A DV++I ++ AE+ K +T LNG V Q+ +A R+ S+ Sbjct: 105 AGPDVQEIFETLPETGTAEEYGKAVTALNGYFVPQVNSAFARQAFKSL 152 >SB_40686| Best HMM Match : rve (HMM E-Value=0.00016) Length = 1586 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKD 231 TP+ AD++ IL G E EK+K+ + K+ Sbjct: 906 TPSKADMKAILHDYGAELSEEKMKEYMKAFKTKN 939 >SB_16972| Best HMM Match : Ribosomal_60s (HMM E-Value=0.51) Length = 1275 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 130 TPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVGG 288 T + AD++ IL G E EK+K+ + L K E L S+ GG Sbjct: 817 TLSKADMKTILHDYGAELSEEKMKEYMKALKTKKFSNHGMMSDEYLESLLKGG 869 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,529,723 Number of Sequences: 59808 Number of extensions: 161713 Number of successful extensions: 638 Number of sequences better than 10.0: 183 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -