BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_B13 (643 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14090| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) 29 3.2 >SB_14090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 31.5 bits (68), Expect = 0.60 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 368 YVHGKKTINTKNNWPIPYLNCYHYSTVQKL 457 Y HG+K I + + W +PY +C YS Q L Sbjct: 93 YSHGQKPITSPSEWTVPY-HCSLYSNTQYL 121 >SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 2065 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 481 KSFTTLKDLXTLXEQYSGIVQVXDSYHKLXSYYARLXSVLLS 606 + F TL+DL E+YS V D +H + A+ +LLS Sbjct: 1081 QGFITLRDLFRWAERYSKTPDVGDGFHDWEHHLAQDGYMLLS 1122 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,805,493 Number of Sequences: 59808 Number of extensions: 306257 Number of successful extensions: 559 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -