BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_B13 (643 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 25 0.47 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 24 1.4 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 1.9 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 1.9 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 23 1.9 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 4.4 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 4.4 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 4.4 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 5.8 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 7.7 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 25.4 bits (53), Expect = 0.47 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = +1 Query: 325 HEKMALPVAQPAEVLRAWQKDDQYEKQLADSISKLLPLQHGSKAIPISSLLYKSF 489 H++ + AEVLR Q ++ D +S + L G +P L +SF Sbjct: 96 HQRSLSSFLKTAEVLRVSGLTQQADQTDRDELSHVRALAAGGNHLPFHEKLVESF 150 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 368 YVHGKKTINTKNNWPIPYLNC-YHYST 445 YV+ T + N W P C Y++ST Sbjct: 283 YVYEDSTYDDINQWVYPLTGCLYYFST 309 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 387 VFLPCT*NFSRLCYWQSHLF 328 +F P F L YW ++LF Sbjct: 421 IFFPIVFAFFNLAYWSTYLF 440 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 387 VFLPCT*NFSRLCYWQSHLF 328 +F P F L YW ++LF Sbjct: 421 IFFPIVFAFFNLAYWSTYLF 440 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 383 KTINTKNNWPIPYLNCYHYS 442 KTI+ NN+ Y N Y+Y+ Sbjct: 88 KTIHNNNNYKYNYNNKYNYN 107 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 383 KTINTKNNWPIPYLNCYHYSTVQKLFQYPLCFINHL 490 KTI+ NN+ Y N + + +KL+ Y + +I + Sbjct: 88 KTIHNNNNYKYNYNNNNYNNNCKKLY-YNINYIEQI 122 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 383 KTINTKNNWPIPYLNCYHYSTVQKLFQYPLCFINHL 490 KTI+ NN+ Y N + + +KL+ Y + +I + Sbjct: 88 KTIHNNNNYKYNYNNNNYNNNCKKLY-YNINYIEQI 122 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 383 KTINTKNNWPIPYLNCYHYSTVQKLFQYPLCFINHL 490 KTI+ NN+ Y N + + +KL+ Y + +I + Sbjct: 88 KTIHNNNNYKYNYNNNNYNNNCKKLY-YNINYIEQI 122 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 550 DSYHKLXSYYARLXSVLLSTFGENLT 627 DS+H+L S+ S +S ENLT Sbjct: 219 DSFHRLSSHTLNHNSDKMSDQQENLT 244 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 7.7 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 554 LSXTWTIPEYCSXRVCRSFKVVNDL*SKEDIGIAF 450 L TW PEY RV ++ D+ S+ I F Sbjct: 340 LQNTWLDPEYPMIRVHKTQSQTIDIYSRIGFPILF 374 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,513 Number of Sequences: 438 Number of extensions: 3335 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -