BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_B10 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_57657| Best HMM Match : PHD (HMM E-Value=0.0012) 28 7.6 >SB_52295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1325 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = -1 Query: 296 VLLGLFNWGDLFLFSGIPINEMCKYAFIISLPLLLVFIFH 177 ++LG N G+L +F+ I E+C+ F+ L LLL+ +FH Sbjct: 808 IILGTQN-GELKMFNIIS-GEVCRCLFMGKLVLLLMVVFH 845 >SB_57657| Best HMM Match : PHD (HMM E-Value=0.0012) Length = 363 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 418 YFSNCTRIRNRMTNKISNSSITW 486 Y +NC I N N ++NSS +W Sbjct: 76 YHTNCCSISNESYNTLANSSCSW 98 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,100,889 Number of Sequences: 59808 Number of extensions: 269582 Number of successful extensions: 1527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1526 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -