BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_B04 (652 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125986-1|AAD22080.1| 704|Drosophila melanogaster putative tra... 91 2e-18 AE014298-1028|AAF46251.3| 704|Drosophila melanogaster CG9653-PA... 91 2e-18 AB023583-1|BAA76710.1| 704|Drosophila melanogaster Brk protein. 91 2e-18 AY052069-1|AAK93493.1| 502|Drosophila melanogaster SD02279p pro... 31 1.8 AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-P... 30 2.4 AE014297-3703|AAN14037.1| 126|Drosophila melanogaster CG31112-P... 28 9.6 >AF125986-1|AAD22080.1| 704|Drosophila melanogaster putative transcription factor protein. Length = 704 Score = 90.6 bits (215), Expect = 2e-18 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +3 Query: 120 RAGSRRIFPPQFKLQVLEAYRRDSQCRGNQRATARKFGIHRRQIQKWLQAE 272 + GSRRIF P FKLQVLE+YR D+ C+GNQRATARK+ IHRRQIQKWLQ E Sbjct: 41 KMGSRRIFTPHFKLQVLESYRNDNDCKGNQRATARKYNIHRRQIQKWLQCE 91 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 525 PRKPFKLFRPYLLEDEDEK 581 P K KLF+PYLL+D++E+ Sbjct: 454 PSKQVKLFKPYLLDDDEEQ 472 >AE014298-1028|AAF46251.3| 704|Drosophila melanogaster CG9653-PA protein. Length = 704 Score = 90.6 bits (215), Expect = 2e-18 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +3 Query: 120 RAGSRRIFPPQFKLQVLEAYRRDSQCRGNQRATARKFGIHRRQIQKWLQAE 272 + GSRRIF P FKLQVLE+YR D+ C+GNQRATARK+ IHRRQIQKWLQ E Sbjct: 41 KMGSRRIFTPHFKLQVLESYRNDNDCKGNQRATARKYNIHRRQIQKWLQCE 91 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 525 PRKPFKLFRPYLLEDEDEK 581 P K KLF+PYLL+D++E+ Sbjct: 454 PSKQVKLFKPYLLDDDEEQ 472 >AB023583-1|BAA76710.1| 704|Drosophila melanogaster Brk protein. Length = 704 Score = 90.6 bits (215), Expect = 2e-18 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +3 Query: 120 RAGSRRIFPPQFKLQVLEAYRRDSQCRGNQRATARKFGIHRRQIQKWLQAE 272 + GSRRIF P FKLQVLE+YR D+ C+GNQRATARK+ IHRRQIQKWLQ E Sbjct: 41 KMGSRRIFTPHFKLQVLESYRNDNDCKGNQRATARKYNIHRRQIQKWLQCE 91 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 525 PRKPFKLFRPYLLEDEDEK 581 P K KLF+PYLL+D++E+ Sbjct: 454 PSKQVKLFKPYLLDDDEEQ 472 >AY052069-1|AAK93493.1| 502|Drosophila melanogaster SD02279p protein. Length = 502 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 525 PRKPFKLFRPYLLEDEDEK 581 P K KLF+PYLL+D++E+ Sbjct: 252 PSKQVKLFKPYLLDDDEEQ 270 >AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-PA protein. Length = 695 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 456 PIDLSVRRCSPXTLAHPPVAPEPPRKPFKL 545 P+DLS+R + PP P PPRK +L Sbjct: 81 PLDLSLRAAASVVPITPPSTPSPPRKRQRL 110 >AE014297-3703|AAN14037.1| 126|Drosophila melanogaster CG31112-PA protein. Length = 126 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 293 VKESSTAGAITSSICCWFPRKCKI 364 V E TA A SS C W PRKC++ Sbjct: 34 VIEWQTALAWESSKCLWTPRKCRL 57 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,610,120 Number of Sequences: 53049 Number of extensions: 440881 Number of successful extensions: 1614 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1608 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2765538900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -