BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_B01 (496 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 3.1 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 4.1 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.5 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.5 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 127 HHRSLGQSDAGEENYELGGHDVL 59 HH+ + AG + L GH VL Sbjct: 920 HHQIQVSTSAGLQTIRLSGHSVL 942 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 238 LQQGLEGRLRVRAATAQRLRQESPGQRSETRTARPRR 348 L+QG++ L + A R SP + +E+ P R Sbjct: 357 LKQGIQFHLYINTAPCGDARIFSPHEENESVDKHPNR 393 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 7.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 264 EPSFQALLKSCASFDLVSELN 202 EP + + ASFD +SE+N Sbjct: 59 EPLLVGMDLTIASFDAISEVN 79 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.6 bits (41), Expect = 9.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 19 CSPVRISSALSLSTAHHGRQVRSSLRLH 102 CS R LS+S GR + S R+H Sbjct: 632 CSVTRGDLPLSISWLKDGRAMGPSERVH 659 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 61 AHHGRQVRSSLRLHRSGPRSDGATRRSRLLQ 153 A +G+ + LHR+ S + +SRL++ Sbjct: 119 ASNGKIYANHCELHRAACHSGSSLTKSRLMR 149 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,621 Number of Sequences: 438 Number of extensions: 1963 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13667319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -