BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_A22 (459 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 28 0.056 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 26 0.17 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.1 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 3.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 3.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 3.7 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 27.9 bits (59), Expect = 0.056 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 8/99 (8%) Frame = +2 Query: 134 NICVGESGDRLTRAAKVLEQL--TGQQPVFSKARYTVR--SFXIRRNEKIAVHCTVRGAK 301 N+ SGD AA ++ T + V R+ V + RN+ +A+HC +G Sbjct: 678 NLAAEHSGDYTCVAANPAAEVRYTAKLQVKVPPRWIVEPTDVSVERNKHVALHCQAQGVP 737 Query: 302 AEEILER---GLKVREY-ELRXDNFSATGNFGFGIQEHI 406 I+ + G K EY ELR ++ + G + +H+ Sbjct: 738 TPTIVWKKATGSKSGEYEELRERAYTKILSNGTLLLQHV 776 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 26.2 bits (55), Expect = 0.17 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = +2 Query: 251 IRRNEKIAVHCTVRGAKAEEILER---GLKVREY-ELRXDNFSATGNFGFGIQEHI 406 + RN+ +A+HC +G I+ + G K EY ELR ++ + G + +H+ Sbjct: 717 VERNKHVALHCQAQGVPTPTIVWKKATGSKSGEYEELRERAYTKILSNGTLLLQHV 772 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.6 bits (46), Expect = 2.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 37 WYTRHDYNFSKR 2 WY HDYN + Sbjct: 208 WYLNHDYNLENK 219 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.6 bits (46), Expect = 2.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 37 WYTRHDYNFSKR 2 WY HDYN + Sbjct: 208 WYLNHDYNLENK 219 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 3.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 348 CGVTTSPPRVILASVFKN 401 C + PPRVIL+S K+ Sbjct: 626 CNLGLEPPRVILSSGAKS 643 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 3.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 348 CGVTTSPPRVILASVFKN 401 C + PPRVIL+S K+ Sbjct: 626 CNLGLEPPRVILSSGAKS 643 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 3.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 348 CGVTTSPPRVILASVFKN 401 C + PPRVIL+S K+ Sbjct: 626 CNLGLEPPRVILSSGAKS 643 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,982 Number of Sequences: 438 Number of extensions: 2481 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12189771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -