BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_A18 (649 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 3.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.9 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 7.8 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 22.6 bits (46), Expect = 3.4 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = -2 Query: 414 HFRQAACHSKSGATRRMYWSWI 349 HFR + H+ S R+++ +W+ Sbjct: 337 HFRSPSTHNMSPWVRQVFLNWM 358 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 249 GGDCISPPPPPLAITITDDHTEPTFEVSRK 160 G D ++ PP PL+I+ E + S K Sbjct: 1390 GSDRLTSPPTPLSISRAGSRDEDSTRDSTK 1419 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/32 (28%), Positives = 12/32 (37%) Frame = +2 Query: 515 CDKCGAXFSKNDFVMRAKTNIYHIDCFXCCAC 610 CD CG F N + + Y + C C Sbjct: 234 CDICGKSFGYNHVLKLHQVAHYGEKVYKCTLC 265 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,896 Number of Sequences: 438 Number of extensions: 4136 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -