BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_A12 (525 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. 150 2e-38 DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. 27 0.29 Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like pr... 26 0.67 Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. 26 0.67 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 4.7 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 4.7 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 6.3 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 6.3 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 8.3 >L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. Length = 229 Score = 150 bits (364), Expect = 2e-38 Identities = 73/76 (96%), Positives = 74/76 (97%) Frame = +2 Query: 41 LQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 220 +QIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN Sbjct: 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60 Query: 221 IQKESTLHLVLRLXGG 268 IQKESTLHLVLRL GG Sbjct: 61 IQKESTLHLVLRLRGG 76 Score = 150 bits (364), Expect = 2e-38 Identities = 73/76 (96%), Positives = 74/76 (97%) Frame = +2 Query: 41 LQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 220 +QIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN Sbjct: 77 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136 Query: 221 IQKESTLHLVLRLXGG 268 IQKESTLHLVLRL GG Sbjct: 137 IQKESTLHLVLRLRGG 152 Score = 150 bits (364), Expect = 2e-38 Identities = 73/76 (96%), Positives = 74/76 (97%) Frame = +2 Query: 41 LQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 220 +QIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212 Query: 221 IQKESTLHLVLRLXGG 268 IQKESTLHLVLRL GG Sbjct: 213 IQKESTLHLVLRLRGG 228 >DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. Length = 144 Score = 27.5 bits (58), Expect = 0.29 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = -2 Query: 410 WVSDC*CVRTLSCDSW*HED--ED---GHSIYGKSFXHSYTSWR-ECEGK 279 W++ C L C S ++D +D SIY +SF +S+ WR C+GK Sbjct: 84 WIAGNEC--HLKCSSLVNDDISDDMRCARSIYRRSFFNSWEGWRNNCQGK 131 >Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like protease ANCHYM1 protein. Length = 259 Score = 26.2 bits (55), Expect = 0.67 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 248 PGEVWILSGCYSLKECGHLLIVSR 177 PG++ +L G SLKE G LL V + Sbjct: 81 PGDLMVLVGTNSLKEGGELLKVDK 104 >Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. Length = 259 Score = 26.2 bits (55), Expect = 0.67 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 248 PGEVWILSGCYSLKECGHLLIVSR 177 PG++ +L G SLKE G LL V + Sbjct: 81 PGDLMVLVGTNSLKEGGELLKVDK 104 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 4.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 70 PRKGFDEYLQLCCSYEKRAWKEK 2 P GFD +Q E+ W+EK Sbjct: 275 PEGGFDAIMQAIVCREQIGWREK 297 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.4 bits (48), Expect = 4.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 70 EDHYIGGGSFRHYRK 114 +DHY+ G F H RK Sbjct: 912 DDHYVPSGFFFHLRK 926 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.0 bits (47), Expect = 6.3 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +2 Query: 137 KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL 259 K P Q R IF G+ +++ + +Q++ HL++ L Sbjct: 588 KREFPDLQNRTIFTGRFVKELYDVRSGCVQEQDGTHLLMNL 628 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 6.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 Query: 299 MKYNCXKMICRKCYARLHPRATNC 370 +K K +CRKC HPR C Sbjct: 627 LKQLSGKAVCRKC----HPRCKKC 646 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 22.6 bits (46), Expect = 8.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 103 VGSFHLQCNGLPRKGFDEYLQ 41 +G F L C LP+KG E L+ Sbjct: 205 IGGF-LSCRQLPKKGTGELLE 224 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 535,827 Number of Sequences: 2352 Number of extensions: 10859 Number of successful extensions: 16 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48205926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -