BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP27_F_O13
(1126 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 25 5.4
AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 24 9.5
>AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione
S-transferase e8 protein.
Length = 217
Score = 24.6 bits (51), Expect = 5.4
Identities = 7/11 (63%), Positives = 8/11 (72%)
Frame = +1
Query: 301 ADTWPN*CQWF 333
AD WP C+WF
Sbjct: 177 ADRWPRVCEWF 187
>AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol
kinase protein.
Length = 555
Score = 23.8 bits (49), Expect = 9.5
Identities = 12/36 (33%), Positives = 16/36 (44%)
Frame = +1
Query: 10 RPYXGLLSSWLVTXIRPFDHXGASTASLVGASRRRL 117
R Y G + +WLV + GA + ASR L
Sbjct: 170 RCYAGTIDTWLVWNLTGGPQGGAFVTDVTNASRTLL 205
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 690,487
Number of Sequences: 2352
Number of extensions: 10390
Number of successful extensions: 14
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 563,979
effective HSP length: 65
effective length of database: 411,099
effective search space used: 127029591
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -