Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP27_F_K19
         (1228 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q0I5T8 Cluster: Haemophilus-specific protein, uncharact...    34   8.6  

>UniRef50_Q0I5T8 Cluster: Haemophilus-specific protein,
           uncharacterized; n=1; Haemophilus somnus 129PT|Rep:
           Haemophilus-specific protein, uncharacterized -
           Haemophilus somnus (strain 129Pt) (Histophilus somni
           (strain 129Pt))
          Length = 256

 Score = 33.9 bits (74), Expect = 8.6
 Identities = 15/49 (30%), Positives = 29/49 (59%)
 Frame = +3

Query: 522 QYRXLISLKASKQKVXEWLNEEVLHCPKXLVEVAEHWEKDPDIYFDASY 668
           ++  LI + A+++++ E+ N E  H P  LV +A+   + PD+Y+   Y
Sbjct: 122 EFTRLIDI-ANEERIWEYRNVEPYHIPYLLVTLADFPIQKPDVYYKTEY 169


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 816,180,624
Number of Sequences: 1657284
Number of extensions: 13884318
Number of successful extensions: 29964
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 29137
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29955
length of database: 575,637,011
effective HSP length: 103
effective length of database: 404,936,759
effective search space used: 123505711495
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)