Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP27_F_G23
         (1178 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    25   1.3  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    24   2.3  

>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 25.0 bits (52), Expect = 1.3
 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 2/33 (6%)
 Frame = -3

Query: 120 EPVPCVERPERTGNT--XXTTPKGQVEEEAEXK 28
           +P+P V+ PE TGN       P   VEE    K
Sbjct: 307 KPLPMVDNPESTGNLVYIYNNPFSDVEERRVSK 339


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 24.2 bits (50), Expect = 2.3
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 624 PXKPXPPPPGP 592
           P KP PPPP P
Sbjct: 338 PPKPAPPPPPP 348


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 176,687
Number of Sequences: 438
Number of extensions: 3335
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 59
effective length of database: 120,501
effective search space used: 40126833
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)