Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP27_F_F09
         (1193 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory recept...    23   4.5  

>AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory receptor
            candidate 34 protein.
          Length = 324

 Score = 23.0 bits (47), Expect = 4.5
 Identities = 18/70 (25%), Positives = 28/70 (40%), Gaps = 1/70 (1%)
 Frame = -2

Query: 1066 AFHLLIKEXNFTTINSFKXI**FTHYEXKRNKFLVWKXQXGAFTFLSPSPLVRXCEC-*S 890
            +F L+I       +N    +  F   + K   FL+      +  FL    L+  C+C  S
Sbjct: 203  SFLLIISYSTLHFVNYIDDLFFFRFEKSKFEPFLISNISLVSLIFLFNCTLIIMCDCVRS 262

Query: 889  ETGKVSSQAK 860
            E  KV   A+
Sbjct: 263  EASKVVKNAQ 272


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 211,238
Number of Sequences: 336
Number of extensions: 4315
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 59
effective length of database: 102,761
effective search space used: 34733218
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)