SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP27_F_D21
         (1142 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_1342 - 36438869-36439459,36439567-36439627,36440751-364411...    29   6.9  

>01_06_1342 -
           36438869-36439459,36439567-36439627,36440751-36441130,
           36441955-36442761
          Length = 612

 Score = 29.1 bits (62), Expect = 6.9
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = -2

Query: 751 SGGPYARLSKRAIKKRSDCVYSLSLHEVSNYRNRV 647
           +  P+A L+ RA+ K   C+ S+ L+++ N  N+V
Sbjct: 296 NAAPFAALALRAMAKHFKCLKSMILNQLRNTSNKV 330


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,972,590
Number of Sequences: 37544
Number of extensions: 373020
Number of successful extensions: 630
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 621
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 630
length of database: 14,793,348
effective HSP length: 83
effective length of database: 11,677,196
effective search space used: 3468127212
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -