Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP26_F_N17
         (1183 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U10506-1|AAA19240.1|  415|Drosophila melanogaster sex combs redu...    31   4.1  

>U10506-1|AAA19240.1|  415|Drosophila melanogaster sex combs reduced
           homeodomainprotein protein.
          Length = 415

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%)
 Frame = +3

Query: 636 FNCYRLNENSFQLMELICL--EMV*TFLRFDRIIEKKKTKEVSMSIVPCYVG 785
           FN Y       ++   +CL    +  + +  R+  KK+ K  SM+IVPC++G
Sbjct: 343 FNRYLTRRRRIEIAHALCLTERQIKIWFQDRRMKWKKEHKMASMNIVPCHMG 394


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 42,022,576
Number of Sequences: 53049
Number of extensions: 779500
Number of successful extensions: 1415
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1374
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1415
length of database: 24,988,368
effective HSP length: 86
effective length of database: 20,426,154
effective search space used: 6270829278
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)