SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP26_F_M17
         (1151 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ396550-1|ABD60145.1|  113|Anopheles gambiae adipokinetic hormo...    26   2.4  
DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    25   5.5  

>DQ396550-1|ABD60145.1|  113|Anopheles gambiae adipokinetic hormone
           II protein.
          Length = 113

 Score = 25.8 bits (54), Expect = 2.4
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +1

Query: 586 DWRSGPRAVPDAP 624
           DW +G RA+PD+P
Sbjct: 38  DWNAGKRAMPDSP 50


>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
           methoprene-tolerant protein protein.
          Length = 1115

 Score = 24.6 bits (51), Expect = 5.5
 Identities = 10/35 (28%), Positives = 14/35 (40%)
 Frame = +3

Query: 57  YRQEVKEGKMDQSRHHKHYSRTDHNRNYQQLGERC 161
           Y Q+   G   Q  HH H+    H++       RC
Sbjct: 172 YHQQQHPGH-SQHHHHHHHHHPHHSQQQHSASPRC 205


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.315    0.139    0.430 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 826,078
Number of Sequences: 2352
Number of extensions: 15047
Number of successful extensions: 17
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 563,979
effective HSP length: 66
effective length of database: 408,747
effective search space used: 129572799
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)

- SilkBase 1999-2023 -