Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP26_F_M15
         (1242 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    24   3.2  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   9.6  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 23.8 bits (49), Expect = 3.2
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 385  PPPPPPP 365
            PPPPPPP
Sbjct: 1355 PPPPPPP 1361



 Score = 23.8 bits (49), Expect = 3.2
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 385  PPPPPPP 365
            PPPPPPP
Sbjct: 1356 PPPPPPP 1362


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 22.2 bits (45), Expect = 9.6
 Identities = 10/31 (32%), Positives = 13/31 (41%)
 Frame = +2

Query: 701  KTKXPFXXPGXXPPENXPAXPXGVXXIPXXP 793
            K + PF  PG  P  N    P  +  +P  P
Sbjct: 1127 KPQKPFTSPGGIPGPNGIKMPSFMEGMPHLP 1157


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.308    0.142    0.465 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 240,554
Number of Sequences: 438
Number of extensions: 5883
Number of successful extensions: 21
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 146,343
effective HSP length: 60
effective length of database: 120,063
effective search space used: 42382239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 43 (21.9 bits)