BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP26_F_M15
(1242 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 3.2
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 9.6
>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
protein.
Length = 1370
Score = 23.8 bits (49), Expect = 3.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = -3
Query: 385 PPPPPPP 365
PPPPPPP
Sbjct: 1355 PPPPPPP 1361
Score = 23.8 bits (49), Expect = 3.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = -3
Query: 385 PPPPPPP 365
PPPPPPP
Sbjct: 1356 PPPPPPP 1362
>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
Length = 1598
Score = 22.2 bits (45), Expect = 9.6
Identities = 10/31 (32%), Positives = 13/31 (41%)
Frame = +2
Query: 701 KTKXPFXXPGXXPPENXPAXPXGVXXIPXXP 793
K + PF PG P N P + +P P
Sbjct: 1127 KPQKPFTSPGGIPGPNGIKMPSFMEGMPHLP 1157
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.308 0.142 0.465
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 240,554
Number of Sequences: 438
Number of extensions: 5883
Number of successful extensions: 21
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 146,343
effective HSP length: 60
effective length of database: 120,063
effective search space used: 42382239
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 43 (21.9 bits)
- SilkBase 1999-2023 -