BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP26_F_K13
(1206 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF210453-1|AAF21041.1| 4559|Drosophila melanogaster dynein heavy... 31 4.2
>AF210453-1|AAF21041.1| 4559|Drosophila melanogaster dynein heavy
chain protein.
Length = 4559
Score = 30.7 bits (66), Expect = 4.2
Identities = 17/58 (29%), Positives = 28/58 (48%)
Frame = -2
Query: 455 YIYHKTNELIQFISMGNMVKSRRNKCSLDRQFRLTLGLISTAISWDTRNSFDDTSKVQ 282
Y Y ++ I++ + + + K +LDR+ RL GLI A ++ D KVQ
Sbjct: 3108 YNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQ 3165
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,011,593
Number of Sequences: 53049
Number of extensions: 519679
Number of successful extensions: 866
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 857
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 866
length of database: 24,988,368
effective HSP length: 87
effective length of database: 20,373,105
effective search space used: 6397154970
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -