Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP26_F_I24
         (1180 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.         25   3.3  
AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal...    25   4.3  

>AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.
          Length = 679

 Score = 25.4 bits (53), Expect = 3.3
 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 2/56 (3%)
 Frame = -2

Query: 219 ANMALHLQPPLSRWWKFSHQLRQHHHP--PG*EQSKHMLIQLLTPFXVLNVQVAGG 58
           A+  LH QP  +      H    HHHP   G  Q+     Q L P   L     GG
Sbjct: 142 AHHPLHYQPAAAAAMHHHHHHPHHHHPGLTGLMQAPSQQQQHLQPVHPLAFHPIGG 197


>AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal
            growth factor receptorprotein.
          Length = 1433

 Score = 25.0 bits (52), Expect = 4.3
 Identities = 11/17 (64%), Positives = 11/17 (64%)
 Frame = -2

Query: 165  HQLRQHHHPPG*EQSKH 115
            HQL QHHH P   QS H
Sbjct: 1328 HQL-QHHHQPQLSQSSH 1343


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 549,736
Number of Sequences: 2352
Number of extensions: 8094
Number of successful extensions: 21
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 66
effective length of database: 408,747
effective search space used: 133251522
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)