SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP26_F_H01
         (1192 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_05_0232 + 23492225-23492250,23492261-23492393,23492513-234927...    29   9.5  

>05_05_0232 +
           23492225-23492250,23492261-23492393,23492513-23492734,
           23493238-23493504,23493631-23493819
          Length = 278

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 16/66 (24%), Positives = 29/66 (43%)
 Frame = -2

Query: 423 GRGCCISSRQVIYKGDAPQALEPPEVRRMNHEQRLNLDALRRLGTVGKLVFDTAVYV*RH 244
           GRGC + +      G     +  P +  +   Q +  ++LR +G +G    D A +  ++
Sbjct: 12  GRGCAVEADSASTAGPPSATIAAPSIGIVTIRQEVAAESLRSIGLLGS--GDPAAFA-KY 68

Query: 243 RVXPWG 226
            V  WG
Sbjct: 69  PVGRWG 74


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,205,258
Number of Sequences: 37544
Number of extensions: 440188
Number of successful extensions: 1357
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1295
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1356
length of database: 14,793,348
effective HSP length: 84
effective length of database: 11,639,652
effective search space used: 3631571424
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -