Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP26_F_H01
         (1192 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK125998-1|BAC86385.1|  181|Homo sapiens protein ( Homo sapiens ...    34   0.88 

>AK125998-1|BAC86385.1|  181|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44010 fis, clone TESTI4024344. ).
          Length = 181

 Score = 34.3 bits (75), Expect = 0.88
 Identities = 26/72 (36%), Positives = 29/72 (40%)
 Frame = -3

Query: 779 ARLRAGYM*IGSCCNARLSKRS*GTAGGCSARAISQSRASGGRYGCGFSRALVASLPPPA 600
           ARLRAG   +G  C A       G   G  ARA +   A+  R G  FS       PP A
Sbjct: 16  ARLRAG---VGGACVAGAKSHGAGLGAGRRARAETHVTAARRRDGWNFSNPKSRDRPPLA 72

Query: 599 VSGAYDSKR*HG 564
            S A      HG
Sbjct: 73  CSRALQDPLAHG 84


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 117,861,012
Number of Sequences: 237096
Number of extensions: 2205220
Number of successful extensions: 4825
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4439
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4825
length of database: 76,859,062
effective HSP length: 92
effective length of database: 55,046,230
effective search space used: 16734053920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)