SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP26_F_F05
         (1253 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0909 - 22515326-22515418,22515992-22516150,22516583-225166...    29   5.8  

>08_02_0909 -
           22515326-22515418,22515992-22516150,22516583-22516658,
           22517980-22518141,22518826-22519259,22519723-22521414
          Length = 871

 Score = 29.5 bits (63), Expect = 5.8
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +2

Query: 881 ALRHVRTGLYXIPKIKLXNSRYSDDPHFIHINRKSIY 991
           A+RH+R G   I KIKL  + +SD+  +  + +   Y
Sbjct: 741 AMRHLRNGCRLIKKIKLQRNTFSDEAVYRFLEQSGGY 777


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,686,694
Number of Sequences: 37544
Number of extensions: 370373
Number of successful extensions: 675
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 659
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 674
length of database: 14,793,348
effective HSP length: 84
effective length of database: 11,639,652
effective search space used: 3876004116
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -