Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP25_F_P15
         (1247 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U15956-1|AAA67444.1|  129|Apis mellifera hymenoptaecin precursor...    23   5.5  

>U15956-1|AAA67444.1|  129|Apis mellifera hymenoptaecin precursor
           protein.
          Length = 129

 Score = 23.0 bits (47), Expect = 5.5
 Identities = 10/33 (30%), Positives = 14/33 (42%)
 Frame = +2

Query: 554 GXPXKRGXXXKKKXXKKGPKXXXNPKXGXGGGF 652
           G   K G    +   ++GP    +P  G  GGF
Sbjct: 95  GKEYKNGFIKGQSEVQRGPGGRLSPYFGINGGF 127


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.308    0.143    0.450 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 236,132
Number of Sequences: 438
Number of extensions: 6390
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 60
effective length of database: 120,063
effective search space used: 42622365
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 43 (21.9 bits)