SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP25_F_H23
         (1151 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.          25   4.2  
AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless female-s...    24   9.6  
AY725819-1|AAU50567.1|  569|Anopheles gambiae fruitless male-spe...    24   9.6  
AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different...    24   9.6  

>AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.
          Length = 1132

 Score = 25.0 bits (52), Expect = 4.2
 Identities = 9/35 (25%), Positives = 20/35 (57%)
 Frame = +2

Query: 53  YKQKMAYKGPPKVQKVMVQPINLIFRYLQNRSRVQ 157
           ++  +A+K PP   K + +P+ ++ +  + R R Q
Sbjct: 454 HQYAIAFKTPPYRHKDITEPVEVLMQLFRPRDRCQ 488


>AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless
           female-specific zinc-fingerC isoform protein.
          Length = 593

 Score = 23.8 bits (49), Expect = 9.6
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +1

Query: 730 PXXVPGPGGGXGG 768
           P  + GPGGG GG
Sbjct: 459 PDNIDGPGGGGGG 471


>AY725819-1|AAU50567.1|  569|Anopheles gambiae fruitless
           male-specific zinc-fingerC isoform protein.
          Length = 569

 Score = 23.8 bits (49), Expect = 9.6
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +1

Query: 730 PXXVPGPGGGXGG 768
           P  + GPGGG GG
Sbjct: 435 PDNIDGPGGGGGG 447


>AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative
           differentiation regulator protein.
          Length = 1283

 Score = 23.8 bits (49), Expect = 9.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 742 PGPGGGXGG 768
           PGPGGG GG
Sbjct: 222 PGPGGGGGG 230


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 573,688
Number of Sequences: 2352
Number of extensions: 9698
Number of successful extensions: 18
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 563,979
effective HSP length: 66
effective length of database: 408,747
effective search space used: 129572799
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -