Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP25_F_G11
         (1256 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript...    25   3.5  
AF515522-1|AAM61889.1|  222|Anopheles gambiae glutathione S-tran...    25   6.1  

>AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase
            protein.
          Length = 1173

 Score = 25.4 bits (53), Expect = 3.5
 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 4/30 (13%)
 Frame = +3

Query: 423  RSLPRMSSWHFRR----RFHVPRYFMCHPF 500
            R +P +++WHFRR     FH+ +    H F
Sbjct: 920  RVIPDIAAWHFRRHGEVNFHLSQVLSGHGF 949


>AF515522-1|AAM61889.1|  222|Anopheles gambiae glutathione
           S-transferase protein.
          Length = 222

 Score = 24.6 bits (51), Expect = 6.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 321 WWRKRCTWRIR 289
           +WR  C+WR+R
Sbjct: 17  YWRSSCSWRVR 27


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,001,501
Number of Sequences: 2352
Number of extensions: 18566
Number of successful extensions: 35
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 32
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35
length of database: 563,979
effective HSP length: 66
effective length of database: 408,747
effective search space used: 143878944
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)