Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP25_F_F19
         (1207 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q26018 Cluster: Serine/threonine-protein kinase; n=2; P...    37   1.2  

>UniRef50_Q26018 Cluster: Serine/threonine-protein kinase; n=2;
           Plasmodium falciparum|Rep: Serine/threonine-protein
           kinase - Plasmodium falciparum
          Length = 765

 Score = 36.7 bits (81), Expect = 1.2
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +3

Query: 477 CLHEYLYYHSVKLFILENKTRNFNIVIFNQIYKEILLHLTILHRH 611
           CL  ++Y H +    + NK R   I+ +++I KEI +H  I H H
Sbjct: 410 CLGIHIYTHEIVAIKILNKKRLIEIINYDKIIKEIEIHKNINHNH 454


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,046,244,920
Number of Sequences: 1657284
Number of extensions: 21223422
Number of successful extensions: 43321
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 41491
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43307
length of database: 575,637,011
effective HSP length: 102
effective length of database: 406,594,043
effective search space used: 121571618857
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)