SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP25_F_D09
         (1234 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A0CEQ9 Cluster: Chromosome undetermined scaffold_172, w...    36   2.8  

>UniRef50_A0CEQ9 Cluster: Chromosome undetermined scaffold_172,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_172,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 209

 Score = 35.5 bits (78), Expect = 2.8
 Identities = 18/70 (25%), Positives = 38/70 (54%), Gaps = 4/70 (5%)
 Frame = +2

Query: 587 PLREIWEQ---VKELLKDVLHILYEYLKTFEVSDY-IRAYEIFIACSSNTKKQFIMELTE 754
           PL+  W+    +K+L+   +HIL   ++  +V D   R Y +   C+S T   F+ +  +
Sbjct: 23  PLKSKWQSKFYLKQLIDHYIHILQSIVRIIDVYDQGTRVYVVQEFCNSGTLFDFMKKKPQ 82

Query: 755 FIGNHLSRQI 784
           ++G+ L +++
Sbjct: 83  YMGDTLQKKV 92


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 935,311,095
Number of Sequences: 1657284
Number of extensions: 15974529
Number of successful extensions: 29503
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 28519
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29497
length of database: 575,637,011
effective HSP length: 103
effective length of database: 404,936,759
effective search space used: 124315585013
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -