BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP25_F_D09
(1234 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A0CEQ9 Cluster: Chromosome undetermined scaffold_172, w... 36 2.8
>UniRef50_A0CEQ9 Cluster: Chromosome undetermined scaffold_172,
whole genome shotgun sequence; n=1; Paramecium
tetraurelia|Rep: Chromosome undetermined scaffold_172,
whole genome shotgun sequence - Paramecium tetraurelia
Length = 209
Score = 35.5 bits (78), Expect = 2.8
Identities = 18/70 (25%), Positives = 38/70 (54%), Gaps = 4/70 (5%)
Frame = +2
Query: 587 PLREIWEQ---VKELLKDVLHILYEYLKTFEVSDY-IRAYEIFIACSSNTKKQFIMELTE 754
PL+ W+ +K+L+ +HIL ++ +V D R Y + C+S T F+ + +
Sbjct: 23 PLKSKWQSKFYLKQLIDHYIHILQSIVRIIDVYDQGTRVYVVQEFCNSGTLFDFMKKKPQ 82
Query: 755 FIGNHLSRQI 784
++G+ L +++
Sbjct: 83 YMGDTLQKKV 92
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 935,311,095
Number of Sequences: 1657284
Number of extensions: 15974529
Number of successful extensions: 29503
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 28519
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29497
length of database: 575,637,011
effective HSP length: 103
effective length of database: 404,936,759
effective search space used: 124315585013
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -