Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP24_F_I01
         (861 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF543192-1|AAN40409.1|  636|Anopheles gambiae amino acid transpo...    28   0.32 

>AF543192-1|AAN40409.1|  636|Anopheles gambiae amino acid
           transporter Ag_AAT8 protein.
          Length = 636

 Score = 28.3 bits (60), Expect = 0.32
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 2/73 (2%)
 Frame = +2

Query: 518 FGDCI-YDKFVKPREEVKDYRTIVSGIRK-EDLINGEDFSIVQKEVADVIRGKILVGHSL 691
           FG+ I Y  + K R  V    TIV+ I     L+ G     +   +A V  GK  VG+ +
Sbjct: 342 FGNIIMYSSYNKFRHNVYRDATIVTSIDTFTSLLAGCTIFGILGHLAHVT-GKTDVGNVV 400

Query: 692 KNDLNVLFLSHPK 730
           K+D  + F+S+P+
Sbjct: 401 KSDAGLAFISYPE 413


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 693,726
Number of Sequences: 2352
Number of extensions: 12942
Number of successful extensions: 66
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 66
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 66
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 91786122
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)