SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP24_F_C22
         (872 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY600513-1|AAT11861.1|  314|Tribolium castaneum spalt-like prote...    24   1.4  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    23   4.1  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    23   4.1  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    23   4.1  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    23   4.1  
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    22   5.5  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    22   5.5  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    22   5.5  
EF222295-1|ABN79655.1|  146|Tribolium castaneum arginine vasopre...    21   9.6  

>AY600513-1|AAT11861.1|  314|Tribolium castaneum spalt-like protein
           protein.
          Length = 314

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +3

Query: 759 STENSQLCAFPQTXTFEPPRHP*IPXEVLP 848
           ST +  L  FP T   +P + P I   +LP
Sbjct: 67  STSSGSLGQFPATPVIDPAKDPAIYSNLLP 96


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 624 AWVWQFWLL 598
           AW+W  WLL
Sbjct: 464 AWIWLLWLL 472


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 624 AWVWQFWLL 598
           AW+W  WLL
Sbjct: 464 AWIWLLWLL 472


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 624 AWVWQFWLL 598
           AW+W  WLL
Sbjct: 464 AWIWLLWLL 472


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 624 AWVWQFWLL 598
           AW+W  WLL
Sbjct: 464 AWIWLLWLL 472


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 624 AWVWQFWLL 598
           AW+W  WLL
Sbjct: 218 AWIWLVWLL 226


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 624 AWVWQFWLL 598
           AW+W  WLL
Sbjct: 451 AWIWLVWLL 459


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 624 AWVWQFWLL 598
           AW+W  WLL
Sbjct: 451 AWIWLVWLL 459


>EF222295-1|ABN79655.1|  146|Tribolium castaneum arginine
           vasopressin-like peptide protein.
          Length = 146

 Score = 21.4 bits (43), Expect = 9.6
 Identities = 7/18 (38%), Positives = 9/18 (50%)
 Frame = +2

Query: 212 QNTGTCPESSCACPETSC 265
           +NTG C      C + SC
Sbjct: 99  KNTGRCAFDGICCSQDSC 116


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,165
Number of Sequences: 336
Number of extensions: 1632
Number of successful extensions: 15
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24099889
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -