SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP24_F_C21
         (1280 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous ho...    29   0.16 
AF131284-1|AAD42962.1|  645|Homo sapiens membrane type 5 matrix ...    29   0.21 
AB021227-1|BAA82967.1|  645|Homo sapiens membrane-type-5 matrix ...    29   0.21 
AB046839-1|BAB13445.1|  869|Homo sapiens KIAA1619 protein protein.     28   0.36 
BC110382-1|AAI10383.1|  843|Homo sapiens sema domain, immunoglob...    28   0.36 
AL133215-2|CAI10916.1|  843|Homo sapiens sema domain, immunoglob...    28   0.36 
BC051030-1|AAH51030.1|  838|Homo sapiens SEMA4G protein protein.       28   0.36 
AL133215-1|CAB92805.1|  838|Homo sapiens sema domain, immunoglob...    28   0.36 
AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein pr...    36   0.42 
AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain...    34   1.3  
X51630-1|CAA35956.1|  575|Homo sapiens Krueppel-like  zinc-finge...    26   1.4  
AL049692-3|CAI95759.2|  517|Homo sapiens Wilms tumor 1 protein.        26   1.4  
AL049692-4|CAI95758.2|  500|Homo sapiens Wilms tumor 1 protein.        26   1.4  
AL049692-2|CAC39220.2|  497|Homo sapiens Wilms tumor 1 protein.        26   1.4  
M80232-1|AAA61299.1|  449|Homo sapiens Wilms' tumor assocated pr...    26   1.4  
AY245105-1|AAO61088.1|  449|Homo sapiens Wilms tumor 1 protein.        26   1.4  
X61631-1|CAA43819.1|  446|Homo sapiens protein ( H.sapiens Wilms...    26   1.4  
BC046461-1|AAH46461.2|  331|Homo sapiens WT1 protein protein.          26   1.4  
BX537637-1|CAD97803.1|  450|Homo sapiens hypothetical protein pr...    26   2.4  
AF129756-16|AAD18085.1| 1229|Homo sapiens BAT3 protein.                26   2.8  
M33521-1|AAA35588.1| 1132|Homo sapiens protein ( Human HLA-B-ass...    26   2.9  
M33519-1|AAA35587.1| 1132|Homo sapiens protein ( Human HLA-B-ass...    26   2.9  
BX511262-9|CAM45800.1| 1132|Homo sapiens HLA-B associated transc...    26   2.9  
AL805934-11|CAI18504.1| 1132|Homo sapiens HLA-B associated trans...    26   2.9  
AL670886-2|CAI17785.1| 1132|Homo sapiens HLA-B associated transc...    26   2.9  
AL662847-2|CAI17659.1| 1132|Homo sapiens HLA-B associated transc...    26   2.9  
AL662801-54|CAI18314.1| 1132|Homo sapiens HLA-B associated trans...    26   2.9  
BX511262-8|CAM45799.1| 1126|Homo sapiens HLA-B associated transc...    26   2.9  
BC003133-1|AAH03133.1| 1126|Homo sapiens HLA-B associated transc...    26   2.9  
BA000025-30|BAB63390.1| 1126|Homo sapiens BAT3 protein.                26   2.9  
AL805934-10|CAI18501.1| 1126|Homo sapiens HLA-B associated trans...    26   2.9  
AL670886-1|CAI17784.1| 1126|Homo sapiens HLA-B associated transc...    26   2.9  
AL662847-1|CAI17658.1| 1126|Homo sapiens HLA-B associated transc...    26   2.9  
AL662801-53|CAI18315.1| 1126|Homo sapiens HLA-B associated trans...    26   2.9  
AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein.     26   2.9  
AF432213-1|AAL99920.1|  991|Homo sapiens CLL-associated antigen ...    26   2.9  
BC052781-1|AAH52781.1|  802|Homo sapiens RANBP9 protein protein.       26   2.9  
BX511262-10|CAM45801.1|  743|Homo sapiens HLA-B associated trans...    26   2.9  
AL805934-12|CAI18508.2|  743|Homo sapiens HLA-B associated trans...    26   2.9  
AL670886-3|CAM25014.1|  743|Homo sapiens HLA-B associated transc...    26   2.9  
AL662847-3|CAO72072.1|  743|Homo sapiens HLA-B associated transc...    26   2.9  
AL662801-55|CAI18316.2|  743|Homo sapiens HLA-B associated trans...    26   2.9  
Z93020-1|CAI21594.1|  729|Homo sapiens RAN binding protein 9 pro...    26   3.0  
AL441883-5|CAI19841.1|  729|Homo sapiens RAN binding protein 9 p...    26   3.0  
AB055311-1|BAB62525.1|  729|Homo sapiens RanBPM protein.               26   3.0  
BC038446-1|AAH38446.1|  673|Homo sapiens SF1 protein protein.          33   3.0  
AF521671-1|AAN03447.1| 2165|Homo sapiens SWI/SNF chromatin remod...    33   3.0  
AF253515-1|AAN70985.1| 1957|Homo sapiens BAF250b subunit protein.      33   3.0  
AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein.     33   3.0  
BC073988-1|AAH73988.1|  682|Homo sapiens FMNL1 protein protein.        26   3.0  
Y08766-1|CAA70019.1|  638|Homo sapiens SF1-Bo isoform protein.         26   3.0  
L49380-1|AAB04033.1|  639|Homo sapiens transcription factor ZFM1...    26   3.0  
M29551-1|AAA35706.1|  524|Homo sapiens protein ( Human calcineur...    26   3.0  
BC028049-1|AAH28049.1|  525|Homo sapiens protein phosphatase 3 (...    26   3.0  
AL359074-2|CAI52473.1|  524|Homo sapiens protein phosphatase 3 (...    26   3.0  
AL353731-5|CAI52487.1|  524|Homo sapiens protein phosphatase 3 (...    26   3.0  
AK123671-1|BAC85674.1|  520|Homo sapiens protein ( Homo sapiens ...    26   3.0  
AJ488506-1|CAD32694.1|  515|Homo sapiens protein phosphatase 3 c...    26   3.0  
M29550-1|AAA35705.1|  514|Homo sapiens protein ( Human calcineur...    26   3.0  
AL359074-3|CAI52474.1|  496|Homo sapiens protein phosphatase 3 (...    26   3.0  
AL353731-6|CAI52488.1|  496|Homo sapiens protein phosphatase 3 (...    26   3.0  
CR456846-1|CAG33127.1|  202|Homo sapiens PRRG2 protein.                26   3.3  
AF009243-1|AAB67071.1|  202|Homo sapiens proline-rich Gla protei...    26   3.3  
BC026032-1|AAH26032.1|  179|Homo sapiens PRRG2 protein protein.        26   3.3  
AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi...    26   3.7  
AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi...    26   3.7  
BC050477-1|AAH50477.1|  904|Homo sapiens zinc finger protein 598...    32   3.9  
BC041015-1|AAH41015.1|  523|Homo sapiens ZNF598 protein protein.       32   3.9  
BC010990-1|AAH10990.2|  661|Homo sapiens ZNF598 protein protein.       32   3.9  
AL834428-1|CAD39089.1|  523|Homo sapiens hypothetical protein pr...    32   3.9  
AK024487-1|BAB15777.1|  399|Homo sapiens FLJ00086 protein protein.     32   3.9  
BC069725-1|AAH69725.1|  390|Homo sapiens heparan sulfate D-gluco...    26   4.0  
BC069664-1|AAH69664.1|  390|Homo sapiens heparan sulfate (glucos...    26   4.0  
BC063301-1|AAH63301.1|  390|Homo sapiens heparan sulfate (glucos...    26   4.0  
AF105377-1|AAD30209.1|  390|Homo sapiens heparan sulfate D-gluco...    26   4.0  
BC043498-1|AAH43498.1|  333|Homo sapiens mitochondrial fission r...    26   4.1  
BC036116-1|AAH36116.1|  333|Homo sapiens mitochondrial fission r...    26   4.1  
D13634-1|BAA02798.1|  314|Homo sapiens KIAA0009 protein.               26   4.1  
CR456910-1|CAG33191.1|  314|Homo sapiens CHPPR protein.                26   4.1  
BX537854-1|CAD97862.1|  290|Homo sapiens hypothetical protein pr...    26   4.1  
BC049204-1|AAH49204.1|  251|Homo sapiens homeobox B4 protein.          26   4.2  
AF307160-1|AAG45052.1|  251|Homo sapiens HOXB4 protein.                26   4.2  
AF287967-4|AAG31554.1|  251|Homo sapiens homeobox B4 protein.          26   4.2  
AL137449-1|CAB70742.1|  246|Homo sapiens hypothetical protein pr...    26   4.2  
D88460-1|BAA20128.1|  505|Homo sapiens N-WASP protein.                 28   5.1  
BC052955-1|AAH52955.1|  505|Homo sapiens Wiskott-Aldrich syndrom...    28   5.1  
AM295156-1|CAL26602.1|  505|Homo sapiens WASL protein protein.         28   5.1  
AC006333-1|AAQ96857.1|  505|Homo sapiens unknown protein.              28   5.1  
X86019-1|CAA60014.1|  494|Homo sapiens SH3-domain interacting pr...    32   5.2  
BX640870-1|CAE45928.1|  510|Homo sapiens hypothetical protein pr...    32   5.2  
BC110288-1|AAI10289.1|  403|Homo sapiens WIPF1 protein protein.        32   5.2  
BC002914-1|AAH02914.1|  358|Homo sapiens WIPF1 protein protein.        32   5.2  
AF031588-1|AAC03767.1|  503|Homo sapiens WASP interacting protei...    32   5.2  
AC010894-2|AAY14708.1|  503|Homo sapiens unknown protein.              32   5.2  
EF078888-1|ABK41959.1|  355|Homo sapiens Kruppel-like factor 2 (...    27   5.3  
BC071983-1|AAH71983.1|  355|Homo sapiens Kruppel-like factor 2 (...    27   5.3  
AF205849-1|AAF13295.1|  355|Homo sapiens Kruppel-like factor pro...    27   5.3  
AF134053-1|AAD55891.1|  355|Homo sapiens Kruppel-like factor LKL...    27   5.3  
AF123344-1|AAD25076.1|  355|Homo sapiens Kruppel-like zinc finge...    27   5.3  
BC035342-1|AAH35342.1|  224|Homo sapiens Similar to Kruppel-like...    27   5.5  
D10250-1|BAA01095.1| 2783|Homo sapiens alpha-fetoprotein enhance...    31   7.6  
AL590383-2|CAH71374.2| 2279|Homo sapiens zinc finger protein 318...    26   7.7  
AL583834-6|CAI14459.2| 2279|Homo sapiens zinc finger protein 318...    26   7.7  
AF121141-1|AAD17298.1| 2099|Homo sapiens endocrine regulator pro...    26   7.7  
AF090114-1|AAD47387.1| 2099|Homo sapiens unknown protein.              26   7.7  
AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein.     26   7.9  
D86968-1|BAA13204.2| 1626|Homo sapiens KIAA0213 protein.               26   7.9  
AF002715-1|AAB68804.1| 1607|Homo sapiens MAP kinase kinase kinas...    26   7.9  
AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein.             26   7.9  
AL031729-5|CAI19619.1| 1603|Homo sapiens AT hook, DNA binding mo...    26   7.9  
AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein.                26   7.9  
BC146770-1|AAI46771.1| 1558|Homo sapiens mitogen-activated prote...    26   7.9  
AL596452-2|CAI41310.1| 1544|Homo sapiens mitogen-activated prote...    26   7.9  
AL591045-1|CAH70640.1| 1544|Homo sapiens mitogen-activated prote...    26   7.9  
AL139393-1|CAI20816.1| 1544|Homo sapiens mitogen-activated prote...    26   7.9  
AL109942-3|CAC12766.2| 1544|Homo sapiens mitogen-activated prote...    26   7.9  
BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 p...    26   7.9  
AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SE...    26   7.9  
AL596452-3|CAI41309.1| 1498|Homo sapiens mitogen-activated prote...    26   7.9  
AL591045-2|CAH70639.1| 1498|Homo sapiens mitogen-activated prote...    26   7.9  
AL139393-2|CAI20815.1| 1498|Homo sapiens mitogen-activated prote...    26   7.9  
AL109942-4|CAI21477.1| 1498|Homo sapiens mitogen-activated prote...    26   7.9  
AL035425-2|CAB90290.1| 1257|Homo sapiens insulin receptor substr...    26   8.0  
AF007567-1|AAC51738.1| 1257|Homo sapiens insulin receptor substr...    26   8.0  
AM404182-1|CAL49296.1| 1220|Homo sapiens breast cancer anti-estr...    26   8.1  
AM404259-1|CAL49295.1| 1200|Homo sapiens breast cancer anti-estr...    26   8.1  
AM404183-1|CAL49297.1| 1200|Homo sapiens breast cancer anti-estr...    26   8.1  
AL096814-1|CAD92526.1| 1200|Homo sapiens transcriptional regulat...    26   8.1  
AF297872-1|AAL01653.1| 1200|Homo sapiens zinc finger transcripti...    26   8.1  
AK131462-1|BAD18607.1| 1103|Homo sapiens protein ( Homo sapiens ...    26   8.1  
BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein.    26   8.1  
AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens ...    26   8.1  
AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein.     26   8.2  
BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein ...    26   8.2  
AY827075-1|AAV87312.1|  927|Homo sapiens F-box protein 11 protein.     26   8.2  
BC043258-1|AAH43258.2|  915|Homo sapiens FBXO11 protein protein.       26   8.2  
AK131399-1|BAD18546.1|  907|Homo sapiens protein ( Homo sapiens ...    26   8.2  
BC000401-1|AAH00401.2|  894|Homo sapiens SF3B2 protein protein.        26   8.3  
BC053577-1|AAH53577.1|  877|Homo sapiens SF3B2 protein protein.        26   8.3  
U41371-1|AAA97461.1|  872|Homo sapiens spliceosome associated pr...    26   8.3  
BX537771-1|CAD97834.1|  799|Homo sapiens hypothetical protein pr...    26   8.3  
U88666-1|AAC05299.1|  686|Homo sapiens serine kinase SRPK2 protein.    26   8.4  
BC068547-1|AAH68547.1|  688|Homo sapiens SRPK2 protein protein.        26   8.4  
BC035214-1|AAH35214.1|  688|Homo sapiens SFRS protein kinase 2 p...    26   8.4  
AC005070-2|AAC29140.1|  675|Homo sapiens serine kinase SRPK2 pro...    26   8.4  
AC005070-1|AAC29141.1|  675|Homo sapiens WUGSC:H_RG152G17.1a pro...    26   8.4  
AK000342-1|BAA91097.1|  649|Homo sapiens protein ( Homo sapiens ...    26   8.5  
DQ124707-1|AAZ38821.1|  578|Homo sapiens modulator of Na,K-ATPas...    26   8.5  
BC085610-1|AAH85610.1|  578|Homo sapiens ZFHX4 protein protein.        26   8.5  
AY274811-1|AAP42076.1|  578|Homo sapiens PX serine/threonine kin...    26   8.5  
AK022987-1|BAB14348.1|  560|Homo sapiens protein ( Homo sapiens ...    26   8.6  
AY437879-1|AAR98521.1|  545|Homo sapiens PX ser/thr kinase v2 pr...    26   8.6  
AY354201-1|AAQ63886.1|  546|Homo sapiens SFRS protein kinase 2 i...    26   8.6  
AC005559-2|AAC33280.2|  528|Homo sapiens hyperpolarization activ...    27   8.6  
BC047745-1|AAH47745.2|  507|Homo sapiens ZFHX4 protein protein.        26   8.6  
AY847220-1|AAX73352.1|  495|Homo sapiens PX serine/threonine kin...    26   8.6  
AY847221-1|AAX73353.1|  441|Homo sapiens PX serine/threonine kin...    26   8.7  
X16667-1|CAA34657.1|  431|Homo sapiens protein ( Human HOX2G mRN...    27   8.7  
U59298-1|AAD10852.1|  431|Homo sapiens hox homeobox transcriptio...    27   8.7  
AF287967-5|AAG31555.1|  431|Homo sapiens homeobox B3 protein.          27   8.7  
AB028974-1|BAA83003.2|  402|Homo sapiens KIAA1051 protein protein.     26   8.8  
AB096175-1|BAD34944.1|  398|Homo sapiens trans-acting transcript...    26   8.8  
BC069026-1|AAH69026.1|  396|Homo sapiens SP5 protein protein.          26   8.8  
AY847222-1|AAX73354.1|  352|Homo sapiens PX serine/threonine kin...    26   8.9  
M35851-1|AAA51772.1|  917|Homo sapiens androgen receptor protein.      31   9.0  
M27430-1|AAA51886.1|  919|Homo sapiens AR protein.                     31   9.0  
M23263-1|AAA51775.1|  918|Homo sapiens androgen receptor protein.      31   9.0  
M21748-1|AAA51771.1|  917|Homo sapiens androgen receptor protein.      31   9.0  
M20132-1|AAA51729.1|  919|Homo sapiens AR protein.                     31   9.0  
L32832-1|AAC14462.1| 3703|Homo sapiens zinc finger homeodomain p...    31   9.0  
L29496-1|AAA51770.1|  734|Homo sapiens AR protein.                     31   9.0  
AL512408-3|CAI23484.1| 2285|Homo sapiens AT rich interactive dom...    31   9.0  
AL356358-1|CAI40496.1|  920|Homo sapiens androgen receptor (dihy...    31   9.0  
AL158016-1|CAI40853.1|  920|Homo sapiens androgen receptor (dihy...    31   9.0  
AL049564-2|CAI43080.1|  920|Homo sapiens androgen receptor (dihy...    31   9.0  
AL034380-9|CAI21623.1| 2285|Homo sapiens AT rich interactive dom...    31   9.0  
AF321917-1|AAK09426.1|  531|Homo sapiens androgen receptor protein.    31   9.0  
AF321916-1|AAK09425.1|  542|Homo sapiens androgen receptor protein.    31   9.0  
AF321915-1|AAK09424.1|  539|Homo sapiens androgen receptor protein.    31   9.0  
AF321914-1|AAK09423.1|  544|Homo sapiens androgen receptor protein.    31   9.0  
AF231056-1|AAG33967.1| 2285|Homo sapiens BRG1-Associated Factor ...    31   9.0  
AC004943-1|AAC79153.1| 2553|Homo sapiens unknown protein.              31   9.0  
BX537864-1|CAD97867.1|  270|Homo sapiens hypothetical protein pr...    26   9.1  
AF174599-1|AAF04520.1|  197|Homo sapiens F-box protein Fbx11 pro...    26   9.4  
AF176706-1|AAF17611.1|  192|Homo sapiens F-box protein FBX11 pro...    26   9.4  
AY225516-1|AAO74853.1|  153|Homo sapiens acetylcholinesterase me...    26   9.7  

>AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous
            homologue 2_splice_variant1 protein.
          Length = 1147

 Score = 29.5 bits (63), Expect(2) = 0.16
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            GGG   P PPPPPP
Sbjct: 538  GGGVPPPPPPPPPP 551



 Score = 26.2 bits (55), Expect(2) = 0.16
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 544 PPPPPPPPP 552


>AF131284-1|AAD42962.1|  645|Homo sapiens membrane type 5 matrix
            metalloproteinase protein.
          Length = 645

 Score = 29.1 bits (62), Expect(2) = 0.21
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = -3

Query: 1053 GGXXAPXPPPPPP 1015
            GG  AP PPPPPP
Sbjct: 6    GGRAAPGPPPPPP 18



 Score = 26.2 bits (55), Expect(2) = 0.21
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 11  PGPPPPPPP 19


>AB021227-1|BAA82967.1|  645|Homo sapiens membrane-type-5 matrix
            metalloproteinase protein.
          Length = 645

 Score = 29.1 bits (62), Expect(2) = 0.21
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = -3

Query: 1053 GGXXAPXPPPPPP 1015
            GG  AP PPPPPP
Sbjct: 6    GGRAAPGPPPPPP 18



 Score = 26.2 bits (55), Expect(2) = 0.21
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 11  PGPPPPPPP 19


>AB046839-1|BAB13445.1|  869|Homo sapiens KIAA1619 protein protein.
          Length = 869

 Score = 28.3 bits (60), Expect(2) = 0.36
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            G G  AP PPPPPP
Sbjct: 790  GEGAPAPPPPPPPP 803



 Score = 26.2 bits (55), Expect(2) = 0.36
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 797 PPPPPPPPP 805


>BC110382-1|AAI10383.1|  843|Homo sapiens sema domain, immunoglobulin
            domain (Ig), transmembrane domain (TM) and short cy
            protein.
          Length = 843

 Score = 28.3 bits (60), Expect(2) = 0.36
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            G G  AP PPPPPP
Sbjct: 764  GEGAPAPPPPPPPP 777



 Score = 26.2 bits (55), Expect(2) = 0.36
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 771 PPPPPPPPP 779


>AL133215-2|CAI10916.1|  843|Homo sapiens sema domain, immunoglobulin
            domain (Ig), transmembrane domain (TM) and short cy
            protein.
          Length = 843

 Score = 28.3 bits (60), Expect(2) = 0.36
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            G G  AP PPPPPP
Sbjct: 764  GEGAPAPPPPPPPP 777



 Score = 26.2 bits (55), Expect(2) = 0.36
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 771 PPPPPPPPP 779


>BC051030-1|AAH51030.1|  838|Homo sapiens SEMA4G protein protein.
          Length = 838

 Score = 28.3 bits (60), Expect(2) = 0.36
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            G G  AP PPPPPP
Sbjct: 759  GEGAPAPPPPPPPP 772



 Score = 26.2 bits (55), Expect(2) = 0.36
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 766 PPPPPPPPP 774


>AL133215-1|CAB92805.1|  838|Homo sapiens sema domain, immunoglobulin
            domain (Ig), transmembrane domain (TM) and short cy
            protein.
          Length = 838

 Score = 28.3 bits (60), Expect(2) = 0.36
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            G G  AP PPPPPP
Sbjct: 759  GEGAPAPPPPPPPP 772



 Score = 26.2 bits (55), Expect(2) = 0.36
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 766 PPPPPPPPP 774


>AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein
            protein.
          Length = 1009

 Score = 35.5 bits (78), Expect = 0.42
 Identities = 17/54 (31%), Positives = 17/54 (31%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPPXXXXXXXXXXGGGGXXXFXXXXXXXXXXXXXPXPPPPPPP 895
            G     P PPPPPP             G                 P PPPPPPP
Sbjct: 435  GAASSGPLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPP 488


>AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4
            protein protein.
          Length = 3567

 Score = 33.9 bits (74), Expect = 1.3
 Identities = 16/48 (33%), Positives = 16/48 (33%)
 Frame = -3

Query: 1038 PXPPPPPPXXXXXXXXXXGGGGXXXFXXXXXXXXXXXXXPXPPPPPPP 895
            P PPPPPP            G                  P PPPPPPP
Sbjct: 1958 PPPPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPP 2005



 Score = 33.1 bits (72), Expect = 2.2
 Identities = 16/48 (33%), Positives = 16/48 (33%)
 Frame = -3

Query: 1038 PXPPPPPPXXXXXXXXXXGGGGXXXFXXXXXXXXXXXXXPXPPPPPPP 895
            P PPPPPP           G                   P PPPPPPP
Sbjct: 1959 PPPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPP 2006



 Score = 26.2 bits (55), Expect(2) = 7.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 2007 PPPPPPPPP 2015



 Score = 26.2 bits (55), Expect(2) = 7.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 2008 PPPPPPPPP 2016



 Score = 26.2 bits (55), Expect(2) = 7.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 3114 PPPPPPPPP 3122



 Score = 23.4 bits (48), Expect(2) = 7.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 2005 PPPPPPPP 2012



 Score = 23.4 bits (48), Expect(2) = 7.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 2006 PPPPPPPP 2013



 Score = 23.4 bits (48), Expect(2) = 7.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 3113 PPPPPPPP 3120


>X51630-1|CAA35956.1|  575|Homo sapiens Krueppel-like  zinc-finger
            protein protein.
          Length = 575

 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            GG    P PPPPPP
Sbjct: 178  GGPAPPPAPPPPPP 191



 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 184 PAPPPPPPP 192



 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 186 PPPPPPPPP 194



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 185  APPPPPPPP 193


>AL049692-3|CAI95759.2|  517|Homo sapiens Wilms tumor 1 protein.
          Length = 517

 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            GG    P PPPPPP
Sbjct: 120  GGPAPPPAPPPPPP 133



 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 128 PPPPPPPPP 136


>AL049692-4|CAI95758.2|  500|Homo sapiens Wilms tumor 1 protein.
          Length = 500

 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            GG    P PPPPPP
Sbjct: 120  GGPAPPPAPPPPPP 133



 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 128 PPPPPPPPP 136


>AL049692-2|CAC39220.2|  497|Homo sapiens Wilms tumor 1 protein.
          Length = 497

 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            GG    P PPPPPP
Sbjct: 120  GGPAPPPAPPPPPP 133



 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 128 PPPPPPPPP 136


>M80232-1|AAA61299.1|  449|Homo sapiens Wilms' tumor assocated protein
            protein.
          Length = 449

 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            GG    P PPPPPP
Sbjct: 52   GGPAPPPAPPPPPP 65



 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 58  PAPPPPPPP 66



 Score = 26.2 bits (55), Expect(2) = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 60  PPPPPPPPP 68



 Score = 25.0 bits (52), Expect(2) = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 59   APPPPPPPP 67


>AY245105-1|AAO61088.1|  449|Homo sapiens Wilms tumor 1 protein.
          Length = 449

 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            GG    P PPPPPP
Sbjct: 52   GGPAPPPAPPPPPP 65



 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 58  PAPPPPPPP 66



 Score = 26.2 bits (55), Expect(2) = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 60  PPPPPPPPP 68



 Score = 25.0 bits (52), Expect(2) = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 59   APPPPPPPP 67


>X61631-1|CAA43819.1|  446|Homo sapiens protein ( H.sapiens Wilms
            tumor gene 1, exon 1. ).
          Length = 446

 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            GG    P PPPPPP
Sbjct: 52   GGPAPPPAPPPPPP 65



 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 58  PAPPPPPPP 66



 Score = 26.2 bits (55), Expect(2) = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 60  PPPPPPPPP 68



 Score = 25.0 bits (52), Expect(2) = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 59   APPPPPPPP 67


>BC046461-1|AAH46461.2|  331|Homo sapiens WT1 protein protein.
          Length = 331

 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            GG    P PPPPPP
Sbjct: 134  GGPAPPPAPPPPPP 147



 Score = 26.2 bits (55), Expect(2) = 1.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 140 PAPPPPPPP 148



 Score = 26.2 bits (55), Expect(2) = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 142 PPPPPPPPP 150



 Score = 25.0 bits (52), Expect(2) = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 141  APPPPPPPP 149


>BX537637-1|CAD97803.1|  450|Homo sapiens hypothetical protein
           protein.
          Length = 450

 Score = 26.2 bits (55), Expect(2) = 2.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 313 PPPPPPPPP 321



 Score = 25.4 bits (53), Expect(2) = 2.4
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -3

Query: 1053 GGXXAPXPPPPPP 1015
            G   AP PPPPPP
Sbjct: 308  GYLTAPPPPPPPP 320


>AF129756-16|AAD18085.1| 1229|Homo sapiens BAT3 protein.
          Length = 1229

 Score = 26.2 bits (55), Expect(2) = 2.8
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 755 PPPPPPPPP 763



 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 756 PPPPPPPPP 764



 Score = 25.0 bits (52), Expect(2) = 2.8
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 753  APPPPPPPP 761



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 755  PPPPPPPP 762


>M33521-1|AAA35588.1| 1132|Homo sapiens protein ( Human
           HLA-B-associated transcript 3 (BAT3) gene, 3' end. ).
          Length = 1132

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 659 PPPPPPPPP 667



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 656  APPPPPPPP 664


>M33519-1|AAA35587.1| 1132|Homo sapiens protein ( Human
           HLA-B-associated transcript 3 (BAT3) mRNA, complete cds.
           ).
          Length = 1132

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 659 PPPPPPPPP 667



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 656  APPPPPPPP 664


>BX511262-9|CAM45800.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 659 PPPPPPPPP 667



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 656  APPPPPPPP 664


>AL805934-11|CAI18504.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 659 PPPPPPPPP 667



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 656  APPPPPPPP 664


>AL670886-2|CAI17785.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 659 PPPPPPPPP 667



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 656  APPPPPPPP 664


>AL662847-2|CAI17659.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 659 PPPPPPPPP 667



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 656  APPPPPPPP 664


>AL662801-54|CAI18314.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 659 PPPPPPPPP 667



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 656  APPPPPPPP 664


>BX511262-8|CAM45799.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 653 PPPPPPPPP 661



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 650  APPPPPPPP 658


>BC003133-1|AAH03133.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 653 PPPPPPPPP 661



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 650  APPPPPPPP 658


>BA000025-30|BAB63390.1| 1126|Homo sapiens BAT3 protein.
          Length = 1126

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 653 PPPPPPPPP 661



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 650  APPPPPPPP 658


>AL805934-10|CAI18501.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 653 PPPPPPPPP 661



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 650  APPPPPPPP 658


>AL670886-1|CAI17784.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 653 PPPPPPPPP 661



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 650  APPPPPPPP 658


>AL662847-1|CAI17658.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 653 PPPPPPPPP 661



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 650  APPPPPPPP 658


>AL662801-53|CAI18315.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 653 PPPPPPPPP 661



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 650  APPPPPPPP 658


>AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein.
          Length = 1100

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 604 PPPPPPPPP 612



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 596  GTDGPVPPPPPP 607


>AF432213-1|AAL99920.1|  991|Homo sapiens CLL-associated antigen
           KW-13 protein.
          Length = 991

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 495 PPPPPPPPP 503



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 487  GTDGPVPPPPPP 498


>BC052781-1|AAH52781.1|  802|Homo sapiens RANBP9 protein protein.
          Length = 802

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 156 PPPPPPPPP 164



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 154  APPPPPPPP 162


>BX511262-10|CAM45801.1|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 688 PPPPPPPPP 696



 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 689 PPPPPPPPP 697



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 686  APPPPPPPP 694



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 688  PPPPPPPP 695


>AL805934-12|CAI18508.2|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 688 PPPPPPPPP 696



 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 689 PPPPPPPPP 697



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 686  APPPPPPPP 694



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 688  PPPPPPPP 695


>AL670886-3|CAM25014.1|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 688 PPPPPPPPP 696



 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 689 PPPPPPPPP 697



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 686  APPPPPPPP 694



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 688  PPPPPPPP 695


>AL662847-3|CAO72072.1|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 688 PPPPPPPPP 696



 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 689 PPPPPPPPP 697



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 686  APPPPPPPP 694



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 688  PPPPPPPP 695


>AL662801-55|CAI18316.2|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 26.2 bits (55), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 688 PPPPPPPPP 696



 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 689 PPPPPPPPP 697



 Score = 25.0 bits (52), Expect(2) = 2.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 686  APPPPPPPP 694



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 688  PPPPPPPP 695


>Z93020-1|CAI21594.1|  729|Homo sapiens RAN binding protein 9
           protein.
          Length = 729

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 83  PPPPPPPPP 91



 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 84  PPPPPPPPP 92



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 81   APPPPPPPP 89



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 83   PPPPPPPP 90


>AL441883-5|CAI19841.1|  729|Homo sapiens RAN binding protein 9
           protein.
          Length = 729

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 83  PPPPPPPPP 91



 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 84  PPPPPPPPP 92



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 81   APPPPPPPP 89



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 83   PPPPPPPP 90


>AB055311-1|BAB62525.1|  729|Homo sapiens RanBPM protein.
          Length = 729

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 83  PPPPPPPPP 91



 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 84  PPPPPPPPP 92



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 81   APPPPPPPP 89



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 83   PPPPPPPP 90


>BC038446-1|AAH38446.1|  673|Homo sapiens SF1 protein protein.
          Length = 673

 Score = 32.7 bits (71), Expect = 3.0
 Identities = 19/54 (35%), Positives = 19/54 (35%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPPXXXXXXXXXXGGGGXXXFXXXXXXXXXXXXXPXPPPPPPP 895
            G G  AP PPPPPP             G                 P PPPPPPP
Sbjct: 39   GAGLLAPGPPPPPPV------------GSMGALTAAFPFAALPPPPPPPPPPPP 80


>AF521671-1|AAN03447.1| 2165|Homo sapiens SWI/SNF chromatin
           remodeling complex subunit OSA2 protein.
          Length = 2165

 Score = 32.7 bits (71), Expect = 3.0
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = -1

Query: 560 FXGXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           + G   P  GGGGG   GG     GGGGG
Sbjct: 227 YPGYSRPGAGGGGGGGGGGGGGSGGGGGG 255


>AF253515-1|AAN70985.1| 1957|Homo sapiens BAF250b subunit protein.
          Length = 1957

 Score = 32.7 bits (71), Expect = 3.0
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = -1

Query: 560 FXGXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           + G   P  GGGGG   GG     GGGGG
Sbjct: 19  YPGYSRPGAGGGGGGGGGGGGGSGGGGGG 47


>AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein.
          Length = 1112

 Score = 32.7 bits (71), Expect = 3.0
 Identities = 17/54 (31%), Positives = 17/54 (31%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPPXXXXXXXXXXGGGGXXXFXXXXXXXXXXXXXPXPPPPPPP 895
            G     P PPPPPP             G                 P PPPPPPP
Sbjct: 538  GAASSGPLPPPPPPLPPSSDTPETVQNGPVT-PPMPPPPPPPPPPPPPPPPPPP 590


>BC073988-1|AAH73988.1|  682|Homo sapiens FMNL1 protein protein.
          Length = 682

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 186 PPPPPPPPP 194



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 178  GTDGPVPPPPPP 189


>Y08766-1|CAA70019.1|  638|Homo sapiens SF1-Bo isoform protein.
          Length = 638

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 10/22 (45%), Positives = 10/22 (45%)
 Frame = -3

Query: 1038 PXPPPPPPXXXXXXXXXXGGGG 973
            P PPPPPP          GG G
Sbjct: 583  PPPPPPPPGSAGMMIPPRGGDG 604



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 581  APPPPPPPP 589


>L49380-1|AAB04033.1|  639|Homo sapiens transcription factor ZFM1
           protein.
          Length = 639

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 582 PPPPPPPPP 590



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 581  APPPPPPPP 589


>M29551-1|AAA35706.1|  524|Homo sapiens protein ( Human calcineurin
           A2 mRNA, complete cds. ).
          Length = 524

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 12  PPPPPPPPP 20



 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 13  PPPPPPPPP 21



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 10   APPPPPPPP 18



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 12   PPPPPPPP 19


>BC028049-1|AAH28049.1|  525|Homo sapiens protein phosphatase 3
           (formerly 2B), catalytic subunit, beta isoform protein.
          Length = 525

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 12  PPPPPPPPP 20



 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 13  PPPPPPPPP 21



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 10   APPPPPPPP 18



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 12   PPPPPPPP 19


>AL359074-2|CAI52473.1|  524|Homo sapiens protein phosphatase 3
           (formerly 2B), catalytic subunit, beta isoform protein.
          Length = 524

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 12  PPPPPPPPP 20



 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 13  PPPPPPPPP 21



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 10   APPPPPPPP 18



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 12   PPPPPPPP 19


>AL353731-5|CAI52487.1|  524|Homo sapiens protein phosphatase 3
           (formerly 2B), catalytic subunit, beta isoform protein.
          Length = 524

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 12  PPPPPPPPP 20



 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 13  PPPPPPPPP 21



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 10   APPPPPPPP 18



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 12   PPPPPPPP 19


>AK123671-1|BAC85674.1|  520|Homo sapiens protein ( Homo sapiens
           cDNA FLJ41677 fis, clone HCASM2002918. ).
          Length = 520

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 459 PPPPPPPPP 467



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 456  APPPPPPPP 464


>AJ488506-1|CAD32694.1|  515|Homo sapiens protein phosphatase 3
           catalytic subunit beta3 protein.
          Length = 515

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 12  PPPPPPPPP 20



 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 13  PPPPPPPPP 21



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 10   APPPPPPPP 18



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 12   PPPPPPPP 19


>M29550-1|AAA35705.1|  514|Homo sapiens protein ( Human calcineurin
           A1 mRNA, complete cds. ).
          Length = 514

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 12  PPPPPPPPP 20



 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 13  PPPPPPPPP 21



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 10   APPPPPPPP 18



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 12   PPPPPPPP 19


>AL359074-3|CAI52474.1|  496|Homo sapiens protein phosphatase 3
           (formerly 2B), catalytic subunit, beta isoform protein.
          Length = 496

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 12  PPPPPPPPP 20



 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 13  PPPPPPPPP 21



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 10   APPPPPPPP 18



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 12   PPPPPPPP 19


>AL353731-6|CAI52488.1|  496|Homo sapiens protein phosphatase 3
           (formerly 2B), catalytic subunit, beta isoform protein.
          Length = 496

 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 12  PPPPPPPPP 20



 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 13  PPPPPPPPP 21



 Score = 25.0 bits (52), Expect(2) = 3.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 1041 APXPPPPPP 1015
            AP PPPPPP
Sbjct: 10   APPPPPPPP 18



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 12   PPPPPPPP 19


>CR456846-1|CAG33127.1|  202|Homo sapiens PRRG2 protein.
          Length = 202

 Score = 26.2 bits (55), Expect(2) = 3.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 164 PLPPPPPPP 172



 Score = 25.0 bits (52), Expect(2) = 3.3
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 160  GPPTPLPPPPPP 171


>AF009243-1|AAB67071.1|  202|Homo sapiens proline-rich Gla protein 2
           protein.
          Length = 202

 Score = 26.2 bits (55), Expect(2) = 3.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 164 PLPPPPPPP 172



 Score = 25.0 bits (52), Expect(2) = 3.3
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 160  GPPTPLPPPPPP 171


>BC026032-1|AAH26032.1|  179|Homo sapiens PRRG2 protein protein.
          Length = 179

 Score = 26.2 bits (55), Expect(2) = 3.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 141 PLPPPPPPP 149



 Score = 25.0 bits (52), Expect(2) = 3.3
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 137  GPPTPLPPPPPP 148


>AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading
           frame 45 protein.
          Length = 1137

 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 928 PPPPPPPPP 936



 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 930 PPPPPPPPP 938



 Score = 26.2 bits (55), Expect(2) = 3.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 931 PPPPPPPPP 939



 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 933 PPPPPPPPP 941



 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 934 PPPPPPPPP 942



 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 937 PPPPPPPPP 945



 Score = 24.6 bits (51), Expect(2) = 3.7
 Identities = 8/14 (57%), Positives = 8/14 (57%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            G     P PPPPPP
Sbjct: 915  GASLPPPPPPPPPP 928



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 927  PPPPPPPP 934



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 929  PPPPPPPP 936



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 932  PPPPPPPP 939



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 933  PPPPPPPP 940



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 936  PPPPPPPP 943


>AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading
           frame 45 protein.
          Length = 1137

 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 928 PPPPPPPPP 936



 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 930 PPPPPPPPP 938



 Score = 26.2 bits (55), Expect(2) = 3.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 931 PPPPPPPPP 939



 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 933 PPPPPPPPP 941



 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 934 PPPPPPPPP 942



 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 937 PPPPPPPPP 945



 Score = 24.6 bits (51), Expect(2) = 3.7
 Identities = 8/14 (57%), Positives = 8/14 (57%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            G     P PPPPPP
Sbjct: 915  GASLPPPPPPPPPP 928



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 927  PPPPPPPP 934



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 929  PPPPPPPP 936



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 932  PPPPPPPP 939



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 933  PPPPPPPP 940



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 936  PPPPPPPP 943


>BC050477-1|AAH50477.1|  904|Homo sapiens zinc finger protein 598
           protein.
          Length = 904

 Score = 32.3 bits (70), Expect = 3.9
 Identities = 14/37 (37%), Positives = 15/37 (40%)
 Frame = +2

Query: 452 GGXLXXKXPPPPPXXXXXXXKKXPPPPXXGXXXPXKK 562
           GG    + PPPP        K  PPPP  G   P  K
Sbjct: 673 GGPCPPRMPPPPGFSAVVLLKGTPPPPPPGLVPPISK 709


>BC041015-1|AAH41015.1|  523|Homo sapiens ZNF598 protein protein.
          Length = 523

 Score = 32.3 bits (70), Expect = 3.9
 Identities = 14/37 (37%), Positives = 15/37 (40%)
 Frame = +2

Query: 452 GGXLXXKXPPPPPXXXXXXXKKXPPPPXXGXXXPXKK 562
           GG    + PPPP        K  PPPP  G   P  K
Sbjct: 292 GGPCPPRMPPPPGFSAVVLLKGTPPPPPPGLVPPISK 328


>BC010990-1|AAH10990.2|  661|Homo sapiens ZNF598 protein protein.
          Length = 661

 Score = 32.3 bits (70), Expect = 3.9
 Identities = 14/37 (37%), Positives = 15/37 (40%)
 Frame = +2

Query: 452 GGXLXXKXPPPPPXXXXXXXKKXPPPPXXGXXXPXKK 562
           GG    + PPPP        K  PPPP  G   P  K
Sbjct: 430 GGPCPPRMPPPPGFSAVVLLKGTPPPPPPGLVPPISK 466


>AL834428-1|CAD39089.1|  523|Homo sapiens hypothetical protein
           protein.
          Length = 523

 Score = 32.3 bits (70), Expect = 3.9
 Identities = 14/37 (37%), Positives = 15/37 (40%)
 Frame = +2

Query: 452 GGXLXXKXPPPPPXXXXXXXKKXPPPPXXGXXXPXKK 562
           GG    + PPPP        K  PPPP  G   P  K
Sbjct: 292 GGPCPPRMPPPPGFSAVVLLKGTPPPPPPGLVPPISK 328


>AK024487-1|BAB15777.1|  399|Homo sapiens FLJ00086 protein protein.
          Length = 399

 Score = 32.3 bits (70), Expect = 3.9
 Identities = 14/37 (37%), Positives = 15/37 (40%)
 Frame = +2

Query: 452 GGXLXXKXPPPPPXXXXXXXKKXPPPPXXGXXXPXKK 562
           GG    + PPPP        K  PPPP  G   P  K
Sbjct: 335 GGPCPPRMPPPPGFSAVVLLKGTPPPPPPGLVPPISK 371


>BC069725-1|AAH69725.1|  390|Homo sapiens heparan sulfate
           D-glucosaminyl 3-O-sulfotransferase 3B1 protein.
          Length = 390

 Score = 26.2 bits (55), Expect(2) = 4.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 20  PQPPPPPPP 28



 Score = 24.6 bits (51), Expect(2) = 4.0
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 16   GRLLPQPPPPPP 27


>BC069664-1|AAH69664.1|  390|Homo sapiens heparan sulfate
           (glucosamine) 3-O-sulfotransferase 3B1 protein.
          Length = 390

 Score = 26.2 bits (55), Expect(2) = 4.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 20  PQPPPPPPP 28



 Score = 24.6 bits (51), Expect(2) = 4.0
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 16   GRLLPQPPPPPP 27


>BC063301-1|AAH63301.1|  390|Homo sapiens heparan sulfate
           (glucosamine) 3-O-sulfotransferase 3B1 protein.
          Length = 390

 Score = 26.2 bits (55), Expect(2) = 4.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 20  PQPPPPPPP 28



 Score = 24.6 bits (51), Expect(2) = 4.0
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 16   GRLLPQPPPPPP 27


>AF105377-1|AAD30209.1|  390|Homo sapiens heparan sulfate
           D-glucosaminyl 3-O-sulfotransferase-3B protein.
          Length = 390

 Score = 26.2 bits (55), Expect(2) = 4.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 20  PQPPPPPPP 28



 Score = 24.6 bits (51), Expect(2) = 4.0
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 16   GRLLPQPPPPPP 27


>BC043498-1|AAH43498.1|  333|Homo sapiens mitochondrial fission
           regulator 1 protein.
          Length = 333

 Score = 26.2 bits (55), Expect(2) = 4.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 185 PHPPPPPPP 193



 Score = 24.6 bits (51), Expect(2) = 4.1
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 181  GTIPPHPPPPPP 192


>BC036116-1|AAH36116.1|  333|Homo sapiens mitochondrial fission
           regulator 1 protein.
          Length = 333

 Score = 26.2 bits (55), Expect(2) = 4.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 185 PHPPPPPPP 193



 Score = 24.6 bits (51), Expect(2) = 4.1
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 181  GTIPPHPPPPPP 192


>D13634-1|BAA02798.1|  314|Homo sapiens KIAA0009 protein.
          Length = 314

 Score = 26.2 bits (55), Expect(2) = 4.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 166 PHPPPPPPP 174



 Score = 24.6 bits (51), Expect(2) = 4.1
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 162  GTIPPHPPPPPP 173


>CR456910-1|CAG33191.1|  314|Homo sapiens CHPPR protein.
          Length = 314

 Score = 26.2 bits (55), Expect(2) = 4.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 166 PHPPPPPPP 174



 Score = 24.6 bits (51), Expect(2) = 4.1
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 162  GTIPPHPPPPPP 173


>BX537854-1|CAD97862.1|  290|Homo sapiens hypothetical protein
           protein.
          Length = 290

 Score = 26.2 bits (55), Expect(2) = 4.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 142 PHPPPPPPP 150



 Score = 24.6 bits (51), Expect(2) = 4.1
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 138  GTIPPHPPPPPP 149


>BC049204-1|AAH49204.1|  251|Homo sapiens homeobox B4 protein.
          Length = 251

 Score = 26.2 bits (55), Expect(2) = 4.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 78  PPPPPPPPP 86



 Score = 26.2 bits (55), Expect(2) = 9.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 79  PPPPPPPPP 87



 Score = 24.6 bits (51), Expect(2) = 4.2
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 72   GPPPPPPPPPPP 83



 Score = 23.4 bits (48), Expect(2) = 9.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 78   PPPPPPPP 85


>AF307160-1|AAG45052.1|  251|Homo sapiens HOXB4 protein.
          Length = 251

 Score = 26.2 bits (55), Expect(2) = 4.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 78  PPPPPPPPP 86



 Score = 26.2 bits (55), Expect(2) = 9.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 79  PPPPPPPPP 87



 Score = 24.6 bits (51), Expect(2) = 4.2
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 72   GPPPPPPPPPPP 83



 Score = 23.4 bits (48), Expect(2) = 9.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 78   PPPPPPPP 85


>AF287967-4|AAG31554.1|  251|Homo sapiens homeobox B4 protein.
          Length = 251

 Score = 26.2 bits (55), Expect(2) = 4.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 78  PPPPPPPPP 86



 Score = 26.2 bits (55), Expect(2) = 9.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 79  PPPPPPPPP 87



 Score = 24.6 bits (51), Expect(2) = 4.2
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 72   GPPPPPPPPPPP 83



 Score = 23.4 bits (48), Expect(2) = 9.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 78   PPPPPPPP 85


>AL137449-1|CAB70742.1|  246|Homo sapiens hypothetical protein
           protein.
          Length = 246

 Score = 26.2 bits (55), Expect(2) = 4.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 73  PPPPPPPPP 81



 Score = 26.2 bits (55), Expect(2) = 9.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 74  PPPPPPPPP 82



 Score = 24.6 bits (51), Expect(2) = 4.2
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -3

Query: 1050 GXXAPXPPPPPP 1015
            G   P PPPPPP
Sbjct: 67   GPPPPPPPPPPP 78



 Score = 23.4 bits (48), Expect(2) = 9.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 73   PPPPPPPP 80


>D88460-1|BAA20128.1|  505|Homo sapiens N-WASP protein.
          Length = 505

 Score = 27.9 bits (59), Expect(2) = 5.1
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            G G  AP PPPPPP
Sbjct: 367  GVGPVAPPPPPPPP 380



 Score = 22.6 bits (46), Expect(2) = 5.1
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P P PPPPP
Sbjct: 381 PPPGPPPPP 389


>BC052955-1|AAH52955.1|  505|Homo sapiens Wiskott-Aldrich
            syndrome-like protein.
          Length = 505

 Score = 27.9 bits (59), Expect(2) = 5.1
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            G G  AP PPPPPP
Sbjct: 367  GVGPVAPPPPPPPP 380



 Score = 22.6 bits (46), Expect(2) = 5.1
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P P PPPPP
Sbjct: 381 PPPGPPPPP 389


>AM295156-1|CAL26602.1|  505|Homo sapiens WASL protein protein.
          Length = 505

 Score = 27.9 bits (59), Expect(2) = 5.1
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            G G  AP PPPPPP
Sbjct: 367  GVGPVAPPPPPPPP 380



 Score = 22.6 bits (46), Expect(2) = 5.1
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P P PPPPP
Sbjct: 381 PPPGPPPPP 389


>AC006333-1|AAQ96857.1|  505|Homo sapiens unknown protein.
          Length = 505

 Score = 27.9 bits (59), Expect(2) = 5.1
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 1056 GGGXXAPXPPPPPP 1015
            G G  AP PPPPPP
Sbjct: 367  GVGPVAPPPPPPPP 380



 Score = 22.6 bits (46), Expect(2) = 5.1
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P P PPPPP
Sbjct: 381 PPPGPPPPP 389


>X86019-1|CAA60014.1|  494|Homo sapiens SH3-domain interacting
           protein protein.
          Length = 494

 Score = 31.9 bits (69), Expect = 5.2
 Identities = 13/20 (65%), Positives = 13/20 (65%)
 Frame = -1

Query: 533 GGGGGXFXGGXKXKXGGGGG 474
           GGGGG F GG     GGGGG
Sbjct: 68  GGGGGGFGGGGGFGGGGGGG 87


>BX640870-1|CAE45928.1|  510|Homo sapiens hypothetical protein
           protein.
          Length = 510

 Score = 31.9 bits (69), Expect = 5.2
 Identities = 13/20 (65%), Positives = 13/20 (65%)
 Frame = -1

Query: 533 GGGGGXFXGGXKXKXGGGGG 474
           GGGGG F GG     GGGGG
Sbjct: 68  GGGGGGFGGGGGFGGGGGGG 87


>BC110288-1|AAI10289.1|  403|Homo sapiens WIPF1 protein protein.
          Length = 403

 Score = 31.9 bits (69), Expect = 5.2
 Identities = 13/20 (65%), Positives = 13/20 (65%)
 Frame = -1

Query: 533 GGGGGXFXGGXKXKXGGGGG 474
           GGGGG F GG     GGGGG
Sbjct: 68  GGGGGGFGGGGGFGGGGGGG 87


>BC002914-1|AAH02914.1|  358|Homo sapiens WIPF1 protein protein.
          Length = 358

 Score = 31.9 bits (69), Expect = 5.2
 Identities = 13/20 (65%), Positives = 13/20 (65%)
 Frame = -1

Query: 533 GGGGGXFXGGXKXKXGGGGG 474
           GGGGG F GG     GGGGG
Sbjct: 68  GGGGGGFGGGGGFGGGGGGG 87


>AF031588-1|AAC03767.1|  503|Homo sapiens WASP interacting protein
           protein.
          Length = 503

 Score = 31.9 bits (69), Expect = 5.2
 Identities = 13/20 (65%), Positives = 13/20 (65%)
 Frame = -1

Query: 533 GGGGGXFXGGXKXKXGGGGG 474
           GGGGG F GG     GGGGG
Sbjct: 68  GGGGGGFGGGGGFGGGGGGG 87


>AC010894-2|AAY14708.1|  503|Homo sapiens unknown protein.
          Length = 503

 Score = 31.9 bits (69), Expect = 5.2
 Identities = 13/20 (65%), Positives = 13/20 (65%)
 Frame = -1

Query: 533 GGGGGXFXGGXKXKXGGGGG 474
           GGGGG F GG     GGGGG
Sbjct: 68  GGGGGGFGGGGGFGGGGGGG 87


>EF078888-1|ABK41959.1|  355|Homo sapiens Kruppel-like factor 2 (lung)
            protein.
          Length = 355

 Score = 26.6 bits (56), Expect(2) = 5.3
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -3

Query: 1053 GGXXAPXPPPPPP 1015
            G   AP PPPPPP
Sbjct: 57   GAEAAPEPPPPPP 69



 Score = 23.8 bits (49), Expect(2) = 5.3
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 915 PPPPPPP 895
           PPPPPPP
Sbjct: 65  PPPPPPP 71


>BC071983-1|AAH71983.1|  355|Homo sapiens Kruppel-like factor 2 (lung)
            protein.
          Length = 355

 Score = 26.6 bits (56), Expect(2) = 5.3
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -3

Query: 1053 GGXXAPXPPPPPP 1015
            G   AP PPPPPP
Sbjct: 57   GAEAAPEPPPPPP 69



 Score = 23.8 bits (49), Expect(2) = 5.3
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 915 PPPPPPP 895
           PPPPPPP
Sbjct: 65  PPPPPPP 71


>AF205849-1|AAF13295.1|  355|Homo sapiens Kruppel-like factor protein.
          Length = 355

 Score = 26.6 bits (56), Expect(2) = 5.3
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -3

Query: 1053 GGXXAPXPPPPPP 1015
            G   AP PPPPPP
Sbjct: 57   GAEAAPEPPPPPP 69



 Score = 23.8 bits (49), Expect(2) = 5.3
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 915 PPPPPPP 895
           PPPPPPP
Sbjct: 65  PPPPPPP 71


>AF134053-1|AAD55891.1|  355|Homo sapiens Kruppel-like factor LKLF
            protein.
          Length = 355

 Score = 26.6 bits (56), Expect(2) = 5.3
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -3

Query: 1053 GGXXAPXPPPPPP 1015
            G   AP PPPPPP
Sbjct: 57   GAEAAPEPPPPPP 69



 Score = 23.8 bits (49), Expect(2) = 5.3
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 915 PPPPPPP 895
           PPPPPPP
Sbjct: 65  PPPPPPP 71


>AF123344-1|AAD25076.1|  355|Homo sapiens Kruppel-like zinc finger
            transcription factor protein.
          Length = 355

 Score = 26.6 bits (56), Expect(2) = 5.3
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -3

Query: 1053 GGXXAPXPPPPPP 1015
            G   AP PPPPPP
Sbjct: 57   GAEAAPEPPPPPP 69



 Score = 23.8 bits (49), Expect(2) = 5.3
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 915 PPPPPPP 895
           PPPPPPP
Sbjct: 65  PPPPPPP 71


>BC035342-1|AAH35342.1|  224|Homo sapiens Similar to Kruppel-like
            factor 2 (lung) protein.
          Length = 224

 Score = 26.6 bits (56), Expect(2) = 5.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -3

Query: 1053 GGXXAPXPPPPPP 1015
            G   AP PPPPPP
Sbjct: 57   GAEAAPEPPPPPP 69



 Score = 23.8 bits (49), Expect(2) = 5.5
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 915 PPPPPPP 895
           PPPPPPP
Sbjct: 65  PPPPPPP 71


>D10250-1|BAA01095.1| 2783|Homo sapiens alpha-fetoprotein enhancer
            binding protein protein.
          Length = 2783

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 13/22 (59%), Positives = 13/22 (59%)
 Frame = -1

Query: 539  PXGGGGGXFXGGXKXKXGGGGG 474
            P GGGGG   GG     GGGGG
Sbjct: 2583 PTGGGGGGSGGGGGGGGGGGGG 2604



 Score = 26.2 bits (55), Expect(2) = 7.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1127 PPPPPPPPP 1135



 Score = 26.2 bits (55), Expect(2) = 7.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1128 PPPPPPPPP 1136



 Score = 23.4 bits (48), Expect(2) = 7.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1126 PPPPPPPP 1133



 Score = 23.4 bits (48), Expect(2) = 7.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1127 PPPPPPPP 1134


>AL590383-2|CAH71374.2| 2279|Homo sapiens zinc finger protein 318
            protein.
          Length = 2279

 Score = 26.2 bits (55), Expect(2) = 7.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1443 PPPPPPPPP 1451



 Score = 26.2 bits (55), Expect(2) = 7.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1445 PPPPPPPPP 1453



 Score = 26.2 bits (55), Expect(2) = 7.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1446 PPPPPPPPP 1454



 Score = 26.2 bits (55), Expect(2) = 7.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1447 PPPPPPPPP 1455



 Score = 23.4 bits (48), Expect(2) = 7.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1442 PPPPPPPP 1449



 Score = 23.4 bits (48), Expect(2) = 7.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1444 PPPPPPPP 1451



 Score = 23.4 bits (48), Expect(2) = 7.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1445 PPPPPPPP 1452



 Score = 23.4 bits (48), Expect(2) = 7.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1446 PPPPPPPP 1453


>AL583834-6|CAI14459.2| 2279|Homo sapiens zinc finger protein 318
            protein.
          Length = 2279

 Score = 26.2 bits (55), Expect(2) = 7.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1443 PPPPPPPPP 1451



 Score = 26.2 bits (55), Expect(2) = 7.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1445 PPPPPPPPP 1453



 Score = 26.2 bits (55), Expect(2) = 7.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1446 PPPPPPPPP 1454



 Score = 26.2 bits (55), Expect(2) = 7.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1447 PPPPPPPPP 1455



 Score = 23.4 bits (48), Expect(2) = 7.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1442 PPPPPPPP 1449



 Score = 23.4 bits (48), Expect(2) = 7.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1444 PPPPPPPP 1451



 Score = 23.4 bits (48), Expect(2) = 7.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1445 PPPPPPPP 1452



 Score = 23.4 bits (48), Expect(2) = 7.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1446 PPPPPPPP 1453


>AF121141-1|AAD17298.1| 2099|Homo sapiens endocrine regulator protein.
          Length = 2099

 Score = 26.2 bits (55), Expect(2) = 7.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1264 PPPPPPPPP 1272



 Score = 23.4 bits (48), Expect(2) = 7.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1263 PPPPPPPP 1270


>AF090114-1|AAD47387.1| 2099|Homo sapiens unknown protein.
          Length = 2099

 Score = 26.2 bits (55), Expect(2) = 7.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1264 PPPPPPPPP 1272



 Score = 23.4 bits (48), Expect(2) = 7.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1263 PPPPPPPP 1270


>AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein.
          Length = 1709

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1406 PPPPPPPPP 1414



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1405 PPPPPPPP 1412


>D86968-1|BAA13204.2| 1626|Homo sapiens KIAA0213 protein.
          Length = 1626

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 95  PPPPPPPPP 103



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 96  PPPPPPPPP 104



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 93   PPPPPPPP 100



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 94   PPPPPPPP 101


>AF002715-1|AAB68804.1| 1607|Homo sapiens MAP kinase kinase kinase
           protein.
          Length = 1607

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 26  PPPPPPPPP 34



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 28  PPPPPPPPP 36



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 25   PPPPPPPP 32



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 27   PPPPPPPP 34


>AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein.
          Length = 1605

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1538 PLPPPPPPP 1546



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1530 PLPPPPPP 1537


>AL031729-5|CAI19619.1| 1603|Homo sapiens AT hook, DNA binding
           motif, containing 1 protein.
          Length = 1603

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 430 PPPPPPPPP 438



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 429  PPPPPPPP 436


>AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein.
          Length = 1584

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1413 PPPPPPPPP 1421



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1414 PPPPPPPPP 1422



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1411 PPPPPPPP 1418



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1413 PPPPPPPP 1420


>BC146770-1|AAI46771.1| 1558|Homo sapiens mitogen-activated protein
           kinase kinase kinase 4 protein.
          Length = 1558

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 28  PPPPPPPPP 36



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 25   PPPPPPPP 32



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33


>AL596452-2|CAI41310.1| 1544|Homo sapiens mitogen-activated protein
           kinase kinase kinase 4 protein.
          Length = 1544

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 28  PPPPPPPPP 36



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 25   PPPPPPPP 32



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33


>AL591045-1|CAH70640.1| 1544|Homo sapiens mitogen-activated protein
           kinase kinase kinase 4 protein.
          Length = 1544

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 28  PPPPPPPPP 36



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 25   PPPPPPPP 32



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33


>AL139393-1|CAI20816.1| 1544|Homo sapiens mitogen-activated protein
           kinase kinase kinase 4 protein.
          Length = 1544

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 28  PPPPPPPPP 36



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 25   PPPPPPPP 32



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33


>AL109942-3|CAC12766.2| 1544|Homo sapiens mitogen-activated protein
           kinase kinase kinase 4 protein.
          Length = 1544

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 28  PPPPPPPPP 36



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 25   PPPPPPPP 32



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33


>BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1
            protein.
          Length = 1542

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1475 PLPPPPPPP 1483



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1467 PLPPPPPP 1474


>AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SEB)
            protein.
          Length = 1542

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921  PXPPPPPPP 895
            P PPPPPPP
Sbjct: 1475 PLPPPPPPP 1483



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 1467 PLPPPPPP 1474


>AL596452-3|CAI41309.1| 1498|Homo sapiens mitogen-activated protein
           kinase kinase kinase 4 protein.
          Length = 1498

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 26  PPPPPPPPP 34



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 28  PPPPPPPPP 36



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 25   PPPPPPPP 32



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 27   PPPPPPPP 34


>AL591045-2|CAH70639.1| 1498|Homo sapiens mitogen-activated protein
           kinase kinase kinase 4 protein.
          Length = 1498

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 26  PPPPPPPPP 34



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 28  PPPPPPPPP 36



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 25   PPPPPPPP 32



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 27   PPPPPPPP 34


>AL139393-2|CAI20815.1| 1498|Homo sapiens mitogen-activated protein
           kinase kinase kinase 4 protein.
          Length = 1498

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 26  PPPPPPPPP 34



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 28  PPPPPPPPP 36



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 25   PPPPPPPP 32



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 27   PPPPPPPP 34


>AL109942-4|CAI21477.1| 1498|Homo sapiens mitogen-activated protein
           kinase kinase kinase 4 protein.
          Length = 1498

 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 26  PPPPPPPPP 34



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 26.2 bits (55), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 28  PPPPPPPPP 36



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 25   PPPPPPPP 32



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 27   PPPPPPPP 34


>AL035425-2|CAB90290.1| 1257|Homo sapiens insulin receptor substrate
           4 protein.
          Length = 1257

 Score = 26.2 bits (55), Expect(2) = 8.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 629 PPPPPPPPP 637



 Score = 26.2 bits (55), Expect(2) = 8.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 630 PPPPPPPPP 638



 Score = 23.4 bits (48), Expect(2) = 8.0
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 628  PPPPPPPP 635



 Score = 23.4 bits (48), Expect(2) = 8.0
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 629  PPPPPPPP 636


>AF007567-1|AAC51738.1| 1257|Homo sapiens insulin receptor substrate
           4 protein.
          Length = 1257

 Score = 26.2 bits (55), Expect(2) = 8.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 629 PPPPPPPPP 637



 Score = 26.2 bits (55), Expect(2) = 8.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 630 PPPPPPPPP 638



 Score = 23.4 bits (48), Expect(2) = 8.0
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 628  PPPPPPPP 635



 Score = 23.4 bits (48), Expect(2) = 8.0
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 629  PPPPPPPP 636


>AM404182-1|CAL49296.1| 1220|Homo sapiens breast cancer
           anti-estrogen resistance 2 protein.
          Length = 1220

 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 562 PPPPPPPPP 570



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 561  PPPPPPPP 568


>AM404259-1|CAL49295.1| 1200|Homo sapiens breast cancer
           anti-estrogen resistance 2 protein.
          Length = 1200

 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 562 PPPPPPPPP 570



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 559  PLPPPPPP 566


>AM404183-1|CAL49297.1| 1200|Homo sapiens breast cancer
           anti-estrogen resistance 2 protein.
          Length = 1200

 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 562 PPPPPPPPP 570



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 559  PLPPPPPP 566


>AL096814-1|CAD92526.1| 1200|Homo sapiens transcriptional regulating
           factor 1 protein.
          Length = 1200

 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 562 PPPPPPPPP 570



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 559  PLPPPPPP 566


>AF297872-1|AAL01653.1| 1200|Homo sapiens zinc finger transcription
           factor TReP-132 protein.
          Length = 1200

 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 562 PPPPPPPPP 570



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 559  PLPPPPPP 566


>AK131462-1|BAD18607.1| 1103|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16624 fis, clone TESTI4015442, moderately
           similar to Mus musculus zinc finger homeodomain 4
           (Zfh4-pending). ).
          Length = 1103

 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 651 PPPPPPPPP 659



 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 652 PPPPPPPPP 660



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 649  PPPPPPPP 656



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 651  PPPPPPPP 658


>BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein.
          Length = 1081

 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 334 PPPPPPPPP 342



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 331  PPPPPPPP 338


>AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33811 fis, clone CTONG2002095. ).
          Length = 1077

 Score = 26.2 bits (55), Expect(2) = 8.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 334 PPPPPPPPP 342



 Score = 23.4 bits (48), Expect(2) = 8.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 331  PPPPPPPP 338


>AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein.
          Length = 1050

 Score = 26.2 bits (55), Expect(2) = 8.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 940 PPPPPPPPP 948



 Score = 26.2 bits (55), Expect(2) = 8.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 941 PPPPPPPPP 949



 Score = 26.2 bits (55), Expect(2) = 8.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 943 PPPPPPPPP 951



 Score = 23.4 bits (48), Expect(2) = 8.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 938  PPPPPPPP 945



 Score = 23.4 bits (48), Expect(2) = 8.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 939  PPPPPPPP 946



 Score = 23.4 bits (48), Expect(2) = 8.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 940  PPPPPPPP 947


>BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein 4
           protein.
          Length = 1015

 Score = 26.2 bits (55), Expect(2) = 8.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 905 PPPPPPPPP 913



 Score = 26.2 bits (55), Expect(2) = 8.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 906 PPPPPPPPP 914



 Score = 26.2 bits (55), Expect(2) = 8.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 908 PPPPPPPPP 916



 Score = 23.4 bits (48), Expect(2) = 8.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 903  PPPPPPPP 910



 Score = 23.4 bits (48), Expect(2) = 8.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 904  PPPPPPPP 911



 Score = 23.4 bits (48), Expect(2) = 8.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 905  PPPPPPPP 912


>AY827075-1|AAV87312.1|  927|Homo sapiens F-box protein 11 protein.
          Length = 927

 Score = 26.2 bits (55), Expect(2) = 8.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 58  PPPPPPPPP 66



 Score = 23.4 bits (48), Expect(2) = 8.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 57   PPPPPPPP 64


>BC043258-1|AAH43258.2|  915|Homo sapiens FBXO11 protein protein.
          Length = 915

 Score = 26.2 bits (55), Expect(2) = 8.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 46  PPPPPPPPP 54



 Score = 23.4 bits (48), Expect(2) = 8.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 45   PPPPPPPP 52


>AK131399-1|BAD18546.1|  907|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16492 fis, clone CTONG2028758, highly  similar
           to Mus musculus zfh-4 mRNA for zinc-finger homeodomain
           protein 4. ).
          Length = 907

 Score = 26.2 bits (55), Expect(2) = 8.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 855 PPPPPPPPP 863



 Score = 26.2 bits (55), Expect(2) = 8.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 856 PPPPPPPPP 864



 Score = 23.4 bits (48), Expect(2) = 8.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 853  PPPPPPPP 860



 Score = 23.4 bits (48), Expect(2) = 8.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 855  PPPPPPPP 862


>BC000401-1|AAH00401.2|  894|Homo sapiens SF3B2 protein protein.
          Length = 894

 Score = 26.2 bits (55), Expect(2) = 8.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 104 PPPPPPPPP 112



 Score = 23.4 bits (48), Expect(2) = 8.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 103  PPPPPPPP 110


>BC053577-1|AAH53577.1|  877|Homo sapiens SF3B2 protein protein.
          Length = 877

 Score = 26.2 bits (55), Expect(2) = 8.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 105 PPPPPPPPP 113



 Score = 23.4 bits (48), Expect(2) = 8.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 104  PPPPPPPP 111


>U41371-1|AAA97461.1|  872|Homo sapiens spliceosome associated
           protein protein.
          Length = 872

 Score = 26.2 bits (55), Expect(2) = 8.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 82  PPPPPPPPP 90



 Score = 23.4 bits (48), Expect(2) = 8.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 81   PPPPPPPP 88


>BX537771-1|CAD97834.1|  799|Homo sapiens hypothetical protein
           protein.
          Length = 799

 Score = 26.2 bits (55), Expect(2) = 8.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 107 PPPPPPPPP 115



 Score = 23.4 bits (48), Expect(2) = 8.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 106  PPPPPPPP 113


>U88666-1|AAC05299.1|  686|Homo sapiens serine kinase SRPK2 protein.
          Length = 686

 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33


>BC068547-1|AAH68547.1|  688|Homo sapiens SRPK2 protein protein.
          Length = 688

 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33


>BC035214-1|AAH35214.1|  688|Homo sapiens SFRS protein kinase 2
           protein.
          Length = 688

 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33


>AC005070-2|AAC29140.1|  675|Homo sapiens serine kinase SRPK2
           protein.
          Length = 675

 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 14  PPPPPPPPP 22



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 13   PPPPPPPP 20


>AC005070-1|AAC29141.1|  675|Homo sapiens WUGSC:H_RG152G17.1a
           protein.
          Length = 675

 Score = 26.2 bits (55), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 14  PPPPPPPPP 22



 Score = 23.4 bits (48), Expect(2) = 8.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 13   PPPPPPPP 20


>AK000342-1|BAA91097.1|  649|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20335 fis, clone HEP11429. ).
          Length = 649

 Score = 26.2 bits (55), Expect(2) = 8.5
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 516 PPPPPPPPP 524



 Score = 23.4 bits (48), Expect(2) = 8.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 515  PPPPPPPP 522


>DQ124707-1|AAZ38821.1|  578|Homo sapiens modulator of Na,K-ATPase
           long form protein.
          Length = 578

 Score = 26.2 bits (55), Expect(2) = 8.5
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 516 PPPPPPPPP 524



 Score = 23.4 bits (48), Expect(2) = 8.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 515  PPPPPPPP 522


>BC085610-1|AAH85610.1|  578|Homo sapiens ZFHX4 protein protein.
          Length = 578

 Score = 26.2 bits (55), Expect(2) = 8.5
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 126 PPPPPPPPP 134



 Score = 26.2 bits (55), Expect(2) = 8.5
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 127 PPPPPPPPP 135



 Score = 23.4 bits (48), Expect(2) = 8.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 124  PPPPPPPP 131



 Score = 23.4 bits (48), Expect(2) = 8.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 126  PPPPPPPP 133


>AY274811-1|AAP42076.1|  578|Homo sapiens PX serine/threonine kinase
           protein.
          Length = 578

 Score = 26.2 bits (55), Expect(2) = 8.5
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 516 PPPPPPPPP 524



 Score = 23.4 bits (48), Expect(2) = 8.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 515  PPPPPPPP 522


>AK022987-1|BAB14348.1|  560|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12925 fis, clone NT2RP2004710, highly similar to
           Mus musculus formin binding protein 30 mRNA. ).
          Length = 560

 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 450 PPPPPPPPP 458



 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 451 PPPPPPPPP 459



 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 453 PPPPPPPPP 461



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 448  PPPPPPPP 455



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 450  PPPPPPPP 457



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 452  PPPPPPPP 459


>AY437879-1|AAR98521.1|  545|Homo sapiens PX ser/thr kinase v2
           protein.
          Length = 545

 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 483 PPPPPPPPP 491



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 482  PPPPPPPP 489


>AY354201-1|AAQ63886.1|  546|Homo sapiens SFRS protein kinase 2
           isoform c protein.
          Length = 546

 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 27  PPPPPPPPP 35



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 26   PPPPPPPP 33


>AC005559-2|AAC33280.2|  528|Homo sapiens hyperpolarization activated
            cyclic nucleotide-gated potassium channel 2 protein.
          Length = 528

 Score = 26.6 bits (56), Expect(2) = 8.6
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -3

Query: 1053 GGXXAPXPPPPPP 1015
            G   AP PPPPPP
Sbjct: 15   GATPAPGPPPPPP 27



 Score = 23.0 bits (47), Expect(2) = 8.6
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPP PP
Sbjct: 36  PPPPPPAPP 44


>BC047745-1|AAH47745.2|  507|Homo sapiens ZFHX4 protein protein.
          Length = 507

 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 55  PPPPPPPPP 63



 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 56  PPPPPPPPP 64



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 53   PPPPPPPP 60



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 55   PPPPPPPP 62


>AY847220-1|AAX73352.1|  495|Homo sapiens PX serine/threonine kinase
           isoform 5 protein.
          Length = 495

 Score = 26.2 bits (55), Expect(2) = 8.6
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 433 PPPPPPPPP 441



 Score = 23.4 bits (48), Expect(2) = 8.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 432  PPPPPPPP 439


>AY847221-1|AAX73353.1|  441|Homo sapiens PX serine/threonine kinase
           isoform 4 protein.
          Length = 441

 Score = 26.2 bits (55), Expect(2) = 8.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 379 PPPPPPPPP 387



 Score = 23.4 bits (48), Expect(2) = 8.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 378  PPPPPPPP 385


>X16667-1|CAA34657.1|  431|Homo sapiens protein ( Human HOX2G mRNA
            from the Hox2 locus. ).
          Length = 431

 Score = 26.6 bits (56), Expect(2) = 8.7
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = +2

Query: 1016 GGGGGGXGAXXPPPXXXXKKKKK 1084
            GGGGGG G    PP     K+ +
Sbjct: 170  GGGGGGGGGDKSPPGSAASKRAR 192



 Score = 23.0 bits (47), Expect(2) = 8.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 896 GGGGGGGXG 922
           GGGGGGG G
Sbjct: 156 GGGGGGGGG 164


>U59298-1|AAD10852.1|  431|Homo sapiens hox homeobox transcription
            factor HOXB3 protein.
          Length = 431

 Score = 26.6 bits (56), Expect(2) = 8.7
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = +2

Query: 1016 GGGGGGXGAXXPPPXXXXKKKKK 1084
            GGGGGG G    PP     K+ +
Sbjct: 170  GGGGGGGGGDKSPPGSAASKRAR 192



 Score = 23.0 bits (47), Expect(2) = 8.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 896 GGGGGGGXG 922
           GGGGGGG G
Sbjct: 156 GGGGGGGGG 164


>AF287967-5|AAG31555.1|  431|Homo sapiens homeobox B3 protein.
          Length = 431

 Score = 26.6 bits (56), Expect(2) = 8.7
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = +2

Query: 1016 GGGGGGXGAXXPPPXXXXKKKKK 1084
            GGGGGG G    PP     K+ +
Sbjct: 170  GGGGGGGGGDKSPPGSAASKRAR 192



 Score = 23.0 bits (47), Expect(2) = 8.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 896 GGGGGGGXG 922
           GGGGGGG G
Sbjct: 156 GGGGGGGGG 164


>AB028974-1|BAA83003.2|  402|Homo sapiens KIAA1051 protein protein.
          Length = 402

 Score = 26.2 bits (55), Expect(2) = 8.8
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 388 PPPPPPPPP 396



 Score = 23.4 bits (48), Expect(2) = 8.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 386  PPPPPPPP 393


>AB096175-1|BAD34944.1|  398|Homo sapiens trans-acting transcription
           factor 5 protein.
          Length = 398

 Score = 26.2 bits (55), Expect(2) = 8.8
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 165 PPPPPPPPP 173



 Score = 23.4 bits (48), Expect(2) = 8.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 164  PPPPPPPP 171


>BC069026-1|AAH69026.1|  396|Homo sapiens SP5 protein protein.
          Length = 396

 Score = 26.2 bits (55), Expect(2) = 8.8
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 163 PPPPPPPPP 171



 Score = 23.4 bits (48), Expect(2) = 8.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 162  PPPPPPPP 169


>AY847222-1|AAX73354.1|  352|Homo sapiens PX serine/threonine kinase
           isoform 3 protein.
          Length = 352

 Score = 26.2 bits (55), Expect(2) = 8.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 290 PPPPPPPPP 298



 Score = 23.4 bits (48), Expect(2) = 8.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 289  PPPPPPPP 296


>M35851-1|AAA51772.1|  917|Homo sapiens androgen receptor protein.
          Length = 917

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 441 GQLYGPCGGGGGGGGGGGGGGGGGGGG 467


>M27430-1|AAA51886.1|  919|Homo sapiens AR protein.
          Length = 919

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 442 GQLYGPCGGGGGGGGGGGGGGGGGGGG 468


>M23263-1|AAA51775.1|  918|Homo sapiens androgen receptor protein.
          Length = 918

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 438 GQLYGPCGGGGGGGGGGGGGGGGGGGG 464


>M21748-1|AAA51771.1|  917|Homo sapiens androgen receptor protein.
          Length = 917

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 441 GQLYGPCGGGGGGGGGGGGGGGGGGGG 467


>M20132-1|AAA51729.1|  919|Homo sapiens AR protein.
          Length = 919

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 442 GQLYGPCGGGGGGGGGGGGGGGGGGGG 468


>L32832-1|AAC14462.1| 3703|Homo sapiens zinc finger homeodomain
            protein protein.
          Length = 3703

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 13/22 (59%), Positives = 13/22 (59%)
 Frame = -1

Query: 539  PXGGGGGXFXGGXKXKXGGGGG 474
            P GGGGG   GG     GGGGG
Sbjct: 3505 PTGGGGGGSGGGGGGGGGGGGG 3526


>L29496-1|AAA51770.1|  734|Homo sapiens AR protein.
          Length = 734

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 254 GQLYGPCGGGGGGGGGGGGGGGGGGGG 280


>AL512408-3|CAI23484.1| 2285|Homo sapiens AT rich interactive domain
            1A (SWI-like) protein.
          Length = 2285

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%)
 Frame = +2

Query: 896  GGGGGGGXGXXXXXXXXXXXKXKXXXP-PPPXXXXXXXXXXGGGGGG--XGAXXPP 1054
            GGGGGGG G           K       P P          GGGGGG   G   PP
Sbjct: 81   GGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPP 136


>AL356358-1|CAI40496.1|  920|Homo sapiens androgen receptor
           (dihydrotestosterone receptor; testicular feminization;
           spina protein.
          Length = 920

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 444 GQLYGPCGGGGGGGGGGGGGGGGGGGG 470


>AL158016-1|CAI40853.1|  920|Homo sapiens androgen receptor
           (dihydrotestosterone receptor; testicular feminization;
           spina protein.
          Length = 920

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 444 GQLYGPCGGGGGGGGGGGGGGGGGGGG 470


>AL049564-2|CAI43080.1|  920|Homo sapiens androgen receptor
           (dihydrotestosterone receptor; testicular feminization;
           spina protein.
          Length = 920

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 444 GQLYGPCGGGGGGGGGGGGGGGGGGGG 470


>AL034380-9|CAI21623.1| 2285|Homo sapiens AT rich interactive domain
            1A (SWI-like) protein.
          Length = 2285

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%)
 Frame = +2

Query: 896  GGGGGGGXGXXXXXXXXXXXKXKXXXP-PPPXXXXXXXXXXGGGGGG--XGAXXPP 1054
            GGGGGGG G           K       P P          GGGGGG   G   PP
Sbjct: 81   GGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPP 136


>AF321917-1|AAK09426.1|  531|Homo sapiens androgen receptor protein.
          Length = 531

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 436 GQLYGPCGGGGGGGGGGGGGGGGGGGG 462


>AF321916-1|AAK09425.1|  542|Homo sapiens androgen receptor protein.
          Length = 542

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 447 GQLYGPCGGGGGGGGGGGGGGGGGGGG 473


>AF321915-1|AAK09424.1|  539|Homo sapiens androgen receptor protein.
          Length = 539

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 444 GQLYGPCGGGGGGGGGGGGGGGGGGGG 470


>AF321914-1|AAK09423.1|  544|Homo sapiens androgen receptor protein.
          Length = 544

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 14/27 (51%), Positives = 14/27 (51%)
 Frame = -1

Query: 554 GXXXPPXGGGGGXFXGGXKXKXGGGGG 474
           G    P GGGGG   GG     GGGGG
Sbjct: 448 GQLYGPCGGGGGGGGGGGGGGGGGGGG 474


>AF231056-1|AAG33967.1| 2285|Homo sapiens BRG1-Associated Factor 250a
            protein.
          Length = 2285

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%)
 Frame = +2

Query: 896  GGGGGGGXGXXXXXXXXXXXKXKXXXP-PPPXXXXXXXXXXGGGGGG--XGAXXPP 1054
            GGGGGGG G           K       P P          GGGGGG   G   PP
Sbjct: 81   GGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPP 136


>AC004943-1|AAC79153.1| 2553|Homo sapiens unknown protein.
          Length = 2553

 Score = 31.1 bits (67), Expect = 9.0
 Identities = 13/22 (59%), Positives = 13/22 (59%)
 Frame = -1

Query: 539  PXGGGGGXFXGGXKXKXGGGGG 474
            P GGGGG   GG     GGGGG
Sbjct: 2355 PTGGGGGGSGGGGGGGGGGGGG 2376


>BX537864-1|CAD97867.1|  270|Homo sapiens hypothetical protein
           protein.
          Length = 270

 Score = 26.2 bits (55), Expect(2) = 9.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 245 PPPPPPPPP 253



 Score = 23.4 bits (48), Expect(2) = 9.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 244  PPPPPPPP 251


>AF174599-1|AAF04520.1|  197|Homo sapiens F-box protein Fbx11
           protein.
          Length = 197

 Score = 26.2 bits (55), Expect(2) = 9.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 43  PPPPPPPPP 51



 Score = 23.4 bits (48), Expect(2) = 9.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 42   PPPPPPPP 49


>AF176706-1|AAF17611.1|  192|Homo sapiens F-box protein FBX11
           protein.
          Length = 192

 Score = 26.2 bits (55), Expect(2) = 9.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 39  PPPPPPPPP 47



 Score = 23.4 bits (48), Expect(2) = 9.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 38   PPPPPPPP 45


>AY225516-1|AAO74853.1|  153|Homo sapiens acetylcholinesterase
           membrane anchor precursor PRiMA variant I protein.
          Length = 153

 Score = 26.2 bits (55), Expect(2) = 9.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = -3

Query: 921 PXPPPPPPP 895
           P PPPPPPP
Sbjct: 62  PPPPPPPPP 70



 Score = 23.4 bits (48), Expect(2) = 9.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 1038 PXPPPPPP 1015
            P PPPPPP
Sbjct: 59   PLPPPPPP 66


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.317    0.153    0.522 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,903,543
Number of Sequences: 237096
Number of extensions: 2706919
Number of successful extensions: 53408
Number of sequences better than 10.0: 202
Number of HSP's better than 10.0 without gapping: 4288
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28444
length of database: 76,859,062
effective HSP length: 92
effective length of database: 55,046,230
effective search space used: 18385440820
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)

- SilkBase 1999-2023 -