Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP24_F_B24
         (888 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine hydroxy...    29   0.049
EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    21   9.8  

>EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine
           hydroxylase protein.
          Length = 532

 Score = 29.1 bits (62), Expect = 0.049
 Identities = 13/58 (22%), Positives = 33/58 (56%), Gaps = 2/58 (3%)
 Frame = +3

Query: 387 IDPNVGLTELPEEYFEGESEA-MRLDKGVMQEIVGAFPGIDEAMSYAE-VMKLVKGMN 554
           +DP + + + P +  +GE ++ +  ++ V+   +   P  ++A+  A  +++L +GMN
Sbjct: 64  VDPEIDIEDKPAQKIDGEDDSGLTEEEVVLSNAIAEGPDAEKALQRAALILRLREGMN 121


>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 21.4 bits (43), Expect = 9.8
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -3

Query: 337 ENFWSNASEILWA 299
           E FWSNA+   WA
Sbjct: 264 ERFWSNATVDDWA 276


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,157
Number of Sequences: 336
Number of extensions: 3592
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24617054
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)