BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP23_F_O23
(1261 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 26 2.0
>EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium
channel alpha2-delta subunit 1 protein.
Length = 1256
Score = 26.2 bits (55), Expect = 2.0
Identities = 9/39 (23%), Positives = 22/39 (56%)
Frame = +3
Query: 147 IISPQSFTAGNGLTKITRQWGNHFSPTYADSLERHFSLT 263
++ P + + T+ +W +H P +A+++ER +L+
Sbjct: 183 VLLPAGVSLDDPETQSAIKWSSHLDPLFANNIERDSALS 221
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 921,821
Number of Sequences: 2352
Number of extensions: 15998
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 563,979
effective HSP length: 66
effective length of database: 408,747
effective search space used: 144287691
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -