Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP23_F_K04
         (1251 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6AJC4 Cluster: Ribonucleoside-diphosphate reductase; n...    35   3.8  

>UniRef50_Q6AJC4 Cluster: Ribonucleoside-diphosphate reductase; n=1;
           Desulfotalea psychrophila|Rep:
           Ribonucleoside-diphosphate reductase - Desulfotalea
           psychrophila
          Length = 785

 Score = 35.1 bits (77), Expect = 3.8
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +3

Query: 408 KKKLFXNIC-TENEVPIFIAKKNPHELRHDTKKKKCLWSMVCLVI 539
           +K ++  +C  ENE+P+ +  K P + R D K K  +W+  C V+
Sbjct: 666 QKSVYIIVCFDENEMPMEVFAKFPFDNRVDLKDKSTMWTTTCRVV 710


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 755,678,522
Number of Sequences: 1657284
Number of extensions: 10933168
Number of successful extensions: 18988
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 18376
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18982
length of database: 575,637,011
effective HSP length: 103
effective length of database: 404,936,759
effective search space used: 126745205567
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)