SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP23_F_E03
         (1293 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000D560E0 Cluster: PREDICTED: similar to Inter-alph...    34   9.2  

>UniRef50_UPI0000D560E0 Cluster: PREDICTED: similar to
           Inter-alpha-trypsin inhibitor heavy chain H4 precursor
           (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain
           4) (Inter-alpha-trypsin inhibitor family heavy
           chain-related protein) (IHRP) (Plasma kallikrein
           sensitive glycoprotein 120) (P...; n=1; Tribolium
           castaneum|Rep: PREDICTED: similar to Inter-alpha-trypsin
           inhibitor heavy chain H4 precursor (ITI heavy chain H4)
           (Inter-alpha-inhibitor heavy chain 4)
           (Inter-alpha-trypsin inhibitor family heavy
           chain-related protein) (IHRP) (Plasma kallikrein
           sensitive glycoprotein 120) (P... - Tribolium castaneum
          Length = 815

 Score = 33.9 bits (74), Expect = 9.2
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = +1

Query: 280 GDAGRCVYLTRCQAARNIT--IDTYKSHYCDVAGFAGVCCP 396
           G AG+CV +  C    N     D Y  + C +  +AGVCCP
Sbjct: 767 GTAGKCVNVFDCPEIFNEINDFDVYLQYSCRLDKYAGVCCP 807


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 796,785,157
Number of Sequences: 1657284
Number of extensions: 13544980
Number of successful extensions: 37655
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 33027
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37245
length of database: 575,637,011
effective HSP length: 103
effective length of database: 404,936,759
effective search space used: 132414320193
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -