SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP23_F_B23
         (1204 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ138190-1|ABA03054.1|  135|Tribolium castaneum bursicon-like pr...    23   4.6  

>DQ138190-1|ABA03054.1|  135|Tribolium castaneum bursicon-like
           protein protein.
          Length = 135

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = -1

Query: 391 FIKTKFLSMEICSMCHMVRTCMHVLLTNEIRVK*RNLIKMKCYKC 257
           F++ + +++  C     VR     +  N + VK R   + KCYKC
Sbjct: 88  FLRERTITLTHCYDPDGVRLTAETV--NSMDVKLREPAECKCYKC 130


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 131,046
Number of Sequences: 336
Number of extensions: 2367
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 59
effective length of database: 102,761
effective search space used: 35041501
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -