BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP23_F_A17
(1286 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
11_08_0034 - 27827583-27827998,27828111-27829430,27829568-27831008 29 6.0
>11_08_0034 - 27827583-27827998,27828111-27829430,27829568-27831008
Length = 1058
Score = 29.5 bits (63), Expect = 6.0
Identities = 19/55 (34%), Positives = 30/55 (54%)
Frame = -3
Query: 300 YIIHASKN*LRWELAHVSFKNTCSTLEFSDESLNLPVPSLRKEFDKLLANFXICL 136
Y +H ++N L+ EL +++ + C L+F D S+N S+ LLAN I L
Sbjct: 417 YHLHIAENHLQGELDFLAYLSNCRKLQFLDISMNSFSGSIP---SSLLANLSINL 468
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,110,237
Number of Sequences: 37544
Number of extensions: 463315
Number of successful extensions: 939
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 916
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 939
length of database: 14,793,348
effective HSP length: 84
effective length of database: 11,639,652
effective search space used: 4004040288
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -