Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP21_F_P15
         (872 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954256-8|CAJ14149.1|  247|Anopheles gambiae putative signal pe...    25   4.0  
AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript...    24   5.3  

>CR954256-8|CAJ14149.1|  247|Anopheles gambiae putative signal
           peptidase protein.
          Length = 247

 Score = 24.6 bits (51), Expect = 4.0
 Identities = 18/67 (26%), Positives = 31/67 (46%)
 Frame = +3

Query: 84  YEYLGEEYPEVLGSILGALKAIVNVIGMTKMTPPIKDLLPRLTPILKNRHEKVQENCIDL 263
           +EYLG+ +   +G  +       NV+   ++TP +  L      I K+  + VQ  C  +
Sbjct: 26  FEYLGD-FVVCVGPSMEPTLMTNNVLITDRITPRLAKLQRGDIIITKSPTKPVQHVCKRI 84

Query: 264 VGRIADR 284
           +G   DR
Sbjct: 85  IGMPGDR 91


>AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1049

 Score = 24.2 bits (50), Expect = 5.3
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 218 NGCKSRQEILYWW 180
           NG  SR++ +YWW
Sbjct: 268 NGATSRRQPVYWW 280


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 812,655
Number of Sequences: 2352
Number of extensions: 15426
Number of successful extensions: 32
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 32
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 93439926
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)