Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP21_F_E23
         (892 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK126796-1|BAC86698.1|  195|Homo sapiens protein ( Homo sapiens ...    31   7.4  

>AK126796-1|BAC86698.1|  195|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44846 fis, clone BRACE3051144. ).
          Length = 195

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 25/72 (34%), Positives = 30/72 (41%)
 Frame = +3

Query: 417 VSITTMISSRGCGCKWPSKAGACWRGETAPCXXXXXXXCPYVTYIFGQRRCFPTLSNCRD 596
           VS+   +S  GC C W S    C       C       C Y++   G    FPT  +CR 
Sbjct: 40  VSLFVSVSVCGCLCLWVS---LCECPCECLCLWVSLLVCGYLSLSVGVSVGFPTCGSCR- 95

Query: 597 SVTTLPLPHFRP 632
           SVT   L  FRP
Sbjct: 96  SVT---LQTFRP 104


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 112,645,545
Number of Sequences: 237096
Number of extensions: 2502075
Number of successful extensions: 6095
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5669
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6095
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11437206932
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)