BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP21_F_D12
(895 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 9.5
>DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein.
Length = 407
Score = 23.4 bits (48), Expect = 9.5
Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 5/45 (11%)
Frame = -1
Query: 211 LLDELKTASATVAEFPG-----CSSDGVDGMLLFNFDDIRFKNII 92
LLD T SA + G CS+DG G++L+ R K+++
Sbjct: 49 LLDRFYTHSALLNYLFGMEGVWCSTDGAHGLMLWFCRTARTKHVV 93
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 536,137
Number of Sequences: 2352
Number of extensions: 7723
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 96334083
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -