Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP20_F_P04
         (969 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ139945-1|ABA29466.1|  399|Anopheles gambiae protein O-fucosylt...    25   4.5  
AJ302660-1|CAC35525.1|  195|Anopheles gambiae hypothetical prote...    24   6.0  

>DQ139945-1|ABA29466.1|  399|Anopheles gambiae protein
           O-fucosyltransferase 1 protein.
          Length = 399

 Score = 24.6 bits (51), Expect = 4.5
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = -2

Query: 560 VWSKFELLSFCPIQQLKYQPSMSHGSCNRALG 465
           +W   E +SFC  +++    S  HG CN   G
Sbjct: 105 LWPPAERISFCYTERMGLDGSTGHG-CNAKSG 135


>AJ302660-1|CAC35525.1|  195|Anopheles gambiae hypothetical protein
           protein.
          Length = 195

 Score = 24.2 bits (50), Expect = 6.0
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 680 IFWLLPWSY 654
           IFW LPWS+
Sbjct: 26  IFWFLPWSF 34


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 777,439
Number of Sequences: 2352
Number of extensions: 13763
Number of successful extensions: 19
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 65
effective length of database: 411,099
effective search space used: 105652443
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)