SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP20_F_G05
         (941 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    25   0.75 
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          23   4.0  
DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.           23   4.0  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      23   4.0  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    22   9.3  

>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 25.4 bits (53), Expect = 0.75
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -2

Query: 634 WLWTPHWW 611
           W+WTPH W
Sbjct: 176 WIWTPHGW 183


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 23.0 bits (47), Expect = 4.0
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = +2

Query: 299 NTXXDYVRGNVPHNELQIYTWMDATLRELTGLVKEVN 409
           N   + V+GN     +Q+Y  +D  +R++ G   E N
Sbjct: 359 NVLGNIVQGNGDSVNVQLYGQLDLLVRKVLGFGYESN 395


>DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.
          Length = 552

 Score = 23.0 bits (47), Expect = 4.0
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 622 PHWWWHSVWGC 590
           P+W WH+V  C
Sbjct: 232 PNWEWHTVGNC 242


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 23.0 bits (47), Expect = 4.0
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = +2

Query: 299 NTXXDYVRGNVPHNELQIYTWMDATLRELTGLVKEVN 409
           N   + V+GN     +Q+Y  +D  +R++ G   E N
Sbjct: 359 NVLGNIVQGNGDSVNVQLYGQLDLLVRKVLGFGYESN 395


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 21.8 bits (44), Expect = 9.3
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -2

Query: 643 INIWLWTP 620
           +N WLWTP
Sbjct: 69  VNNWLWTP 76


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 147,793
Number of Sequences: 438
Number of extensions: 2464
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 30839445
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -