Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP20_F_F04
         (920 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly pro...    24   2.2  
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    24   2.2  
DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    23   3.0  
AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    23   3.0  
DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    22   6.8  
AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly pro...    22   9.0  

>AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly
           protein MRJP6 protein.
          Length = 437

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 548 YPDWLWRSFKN 580
           YPDW W ++K+
Sbjct: 111 YPDWSWANYKD 121


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 548 YPDWLWRSFKN 580
           YPDW W ++K+
Sbjct: 111 YPDWSWANYKD 121


>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 23.4 bits (48), Expect = 3.0
 Identities = 9/18 (50%), Positives = 14/18 (77%)
 Frame = -3

Query: 300 VLDAVVSLICNTLCLSSL 247
           ++ A V+LIC+ LC+S L
Sbjct: 284 MIAASVNLICHILCMSDL 301


>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 3.0
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +2

Query: 458 VWTPHHQKW 484
           +WT HH KW
Sbjct: 61  IWTDHHLKW 69


>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 22.2 bits (45), Expect = 6.8
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = +3

Query: 252 KKDRVYYISEKLLHLAQTVKPDNLISAGTCFGKFT 356
           +KD   Y+S + L  A       LIS G   GK T
Sbjct: 105 QKDNKSYLSLRSLLSADVAVATPLISMGALLGKTT 139


>AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly
           protein 8 protein.
          Length = 416

 Score = 21.8 bits (44), Expect = 9.0
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = +2

Query: 548 YPDWLWRSFKN 580
           YPDW W   +N
Sbjct: 105 YPDWTWAKNEN 115


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 212,186
Number of Sequences: 438
Number of extensions: 4734
Number of successful extensions: 25
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29992872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)