SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP19_F_M07
         (902 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory recept...    25   1.1  
U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.           23   2.5  

>AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory receptor
           candidate 31 protein.
          Length = 250

 Score = 24.6 bits (51), Expect = 1.1
 Identities = 10/33 (30%), Positives = 20/33 (60%)
 Frame = -2

Query: 634 HFRQVYLKVAVKNDGSYLFIVF*ILDVFAIVLR 536
           H+R   L V + N+ SY+ IV    +++ I+++
Sbjct: 148 HYRLYQLSVLIDNNMSYIIIVSFATNLYFIIIQ 180


>U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.
          Length = 425

 Score = 23.4 bits (48), Expect = 2.5
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -3

Query: 738 PVPKPKRPSFMG 703
           P+P P+RPSF G
Sbjct: 142 PLPAPERPSFEG 153


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 162,054
Number of Sequences: 336
Number of extensions: 3148
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 25134219
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -