SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP19_F_D19
         (902 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor pr...    24   2.2  
AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase ...    23   5.0  

>AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor
           protein.
          Length = 501

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 14/52 (26%), Positives = 20/52 (38%), Gaps = 1/52 (1%)
 Frame = +2

Query: 104 SKXXPGHGKPMVKVDGKTFTFLNSKCEAAHLMRRNPR*SN-MDCPVQAQVQK 256
           S   PGHG P VK    +                 PR S+   CP+  +++K
Sbjct: 269 SDVQPGHGSPPVKQHRSSSASTTCSGHTVRCFTGGPRKSHESQCPMLQKLEK 320


>AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase
           protein.
          Length = 510

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 237 YRRKFKKGQEEE 272
           YRR FKK QEE+
Sbjct: 259 YRRNFKKMQEEK 270


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 172,380
Number of Sequences: 438
Number of extensions: 2549
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29267238
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -