Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP18_F_O08
         (1366 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       23   4.7  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                23   6.2  

>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 23.4 bits (48), Expect = 4.7
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = -1

Query: 655 ISSQESPFSKPSLAMSSIVGFSGSTTMLATLSPWRRISASSPVRRS 518
           ++S E P S  S   SSI   + ST +++   P   +S  SPV  S
Sbjct: 350 MASPEPPKSSESSTGSSIPKLNLSTALMSQPPPNFGVSQVSPVSMS 395


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 23.0 bits (47), Expect = 6.2
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -3

Query: 707 HGLFAEHPRLHG 672
           HG+ ++HP+ HG
Sbjct: 192 HGILSQHPQQHG 203


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 191,949
Number of Sequences: 438
Number of extensions: 3403
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 60
effective length of database: 120,063
effective search space used: 47304822
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)